PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast08G015900.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 141aa MW: 15285.3 Da PI: 5.0522 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.3 | 2.5e-54 | 18 | 113 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 req+rflPian++rim++ +P+n+ki+kdake++qecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+ylk yre Brast08G015900.2.p 18 REQERFLPIANIGRIMRRGVPENGKIAKDAKESIQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLKLYRE 108 89***************************************************************************************** PP NF-YB 93 legek 97 +eg++ Brast08G015900.2.p 109 MEGDT 113 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-48 | 16 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.88E-38 | 20 | 121 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-26 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-19 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.2E-19 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 2.2E-19 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MSDAVGTPEE GGGGAAAREQ ERFLPIANIG RIMRRGVPEN GKIAKDAKES IQECVSEFIS 60 FITSEASDKC MKEKRKTING DDLIWSMGTL GFEDYVEPLK LYLKLYREME GDTTKGSRSE 120 QAGKKGIVLN GQPGSSFNGM * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 7e-46 | 18 | 108 | 3 | 93 | NF-YB |
4awl_B | 7e-46 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 7e-46 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast08G015900.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF764603 | 1e-156 | JF764603.1 Hordeum vulgare NF-YB4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567850.1 | 3e-98 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | Q65XK1 | 1e-72 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A3B6A1E8 | 7e-88 | A0A3B6A1E8_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A452ZZ41 | 1e-87 | A0A452ZZ41_AEGTS; Uncharacterized protein | ||||
STRING | BRADI2G15800.1 | 1e-97 | (Brachypodium distachyon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 7e-56 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast08G015900.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|