PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G065300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ARF
Protein Properties Length: 1064aa    MW: 118195 Da    PI: 6.4824
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G065300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.2e-23127228199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F  
  Brast07G065300.1.p 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfaMQPPAQ--ELMAKDLHDISWKFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI- 214
                         99*****************************95444444..8************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          ++++ +l+++++r+
  Brast07G065300.1.p 215 -RDEKSQLLLGIRRS 228
                         .45677789999986 PP

2Auxin_resp122.92.3e-40253335183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  Brast07G065300.1.p 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 335
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-43117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-39120242IPR015300DNA-binding pseudobarrel domain
CDDcd100175.58E-19126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
SMARTSM010191.6E-22127229IPR003340B3 DNA binding domain
PfamPF023626.5E-21127228IPR003340B3 DNA binding domain
PfamPF065073.8E-35253335IPR010525Auxin response factor
PfamPF023093.2E-99431033IPR033389AUX/IAA domain
PROSITE profilePS5174525.3569471040IPR000270PB1 domain
SuperFamilySSF542772.26E-79621026No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1064 aa     Download sequence    Send to blast
MKDQGSAGVS PGPPEGEKKA INSELWHACA GPLVAMPPVG SLVVYFPQGH SEQVAASMHK  60
EVDVIPNYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVSKYDREAM LASELGLKQN  120
KQPMEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFAM QPPAQELMAK DLHDISWKFR  180
HIFRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRSTR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPVRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQSQ LFPGLSLVQW  420
MAMQQNPQML PASAPAVQSP YLTSSALAMQ DGMGTGNEDP TRRLNIQGQN IGLPNFQVGS  480
KMDHSVMAQH QQQPHQLSQQ QQVQPSQQSS MALQQQQAQL LQQNAIHLQQ QQEHLQRQQS  540
QSQQQQEHLQ RQQSQPQQQL KTAESMEQHK LREQQPQGGQ AVSQAQLLSP IFQPSSSQLQ  600
QLGLPKSPTQ RPGFPGLQTA GSLQQPALTQ TPQVQQAAEY QQALLQSQQQ QIQQLSQPEM  660
QLQLLQKIQH QNMLSQLNPQ HQSQLIQQLS QKNQEFLQQQ ILQHQLSGSD VLGQFKQSQQ  720
TPSNHMTGSL TPQQLVRSQS ALAESEDPSS STAPSAGRIS PMNSLSKTQH SSRNLTDMTT  780
SPHIDNLLQE IQSKSDNRNK NDRQGSKETI PVPSRYPVSD QLDASSATSF CLDESPREGF  840
SFPPVCLDSS AQVDPRDNFL IAENVDSLMP DALLSRGMAS GKSICDLPSG QRDHREVENE  900
LSSAAFSSQS FGVADMSFKP GCSGDMAVND GGMPSQGLWN NQTQRMRTFT KVQKRGSVGR  960
SIDITRYRNY DELRHDLACM FGIQGQLEDP YRMDWKLVYV DHENDILLVG DDPWEEFVGC  1020
VKSIKILSSV EVQQMSLDGD LGGIPSQAQA CSASDDANAW RGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1621735647388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast07G065300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3742620.0AK374262.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3058N24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564148.10.0auxin response factor 16 isoform X1
RefseqXP_014753144.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLI1H0270.0I1H027_BRADI; Auxin response factor
STRINGBRADI1G46602.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]