PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G241500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 382aa    MW: 43055.8 Da    PI: 7.4043
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G241500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-52161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         l pGfrFhPtdeelv++yLkkk+++k++++ e i+++diyk++PwdLpk ++++e+ewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++
  Brast03G241500.1.p  16 LLPGFRFHPTDEELVSFYLKKKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGETEWYFYCPRDRKYRNSARPNRVTAAGFWKATGTDRP 105
                         579***************************.89***************88888999*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  Brast03G241500.1.p 106 IYSSeGTRCIGLKKSLVFYKGRAARGMKTDWMMHEFRL 143
                         ***856667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5715174IPR003441NAC domain
PROSITE profilePS5100556.99216174IPR003441NAC domain
PfamPF023659.5E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEGRNDISMD KSDEILLPGF RFHPTDEELV SFYLKKKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGET EWYFYCPRDR KYRNSARPNR VTAAGFWKAT GTDRPIYSSE GTRCIGLKKS  120
LVFYKGRAAR GMKTDWMMHE FRLPSLADPS LPKRPIDKNI PLNDSWTICR IFKKTSSMAQ  180
RAMSHTWGPP LTTEQHIFSA MQPVQASHFP LESSSCSLQV AAATASQFTG KYDFQGQQQQ  240
FQKPSNAQDG SSCKVISFNC SPTLEAQKCP IILPFQAQAP QKPDDAAPPQ IFDIMEFGQP  300
EQITGFVIDS SADVNAGMNT RNQDPSTRKA GNALSMNTEW EAPGRLNFPF DLGADSPDDW  360
KCNIPWESFL SPTVPAEMPH Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521617717168NO APICAL MERISTEM PROTEIN
1ut4_B2e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_A2e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_B2e-521617717168NO APICAL MERISTEM PROTEIN
3swm_A2e-521617720171NAC domain-containing protein 19
3swm_B2e-521617720171NAC domain-containing protein 19
3swm_C2e-521617720171NAC domain-containing protein 19
3swm_D2e-521617720171NAC domain-containing protein 19
3swp_A2e-521617720171NAC domain-containing protein 19
3swp_B2e-521617720171NAC domain-containing protein 19
3swp_C2e-521617720171NAC domain-containing protein 19
3swp_D2e-521617720171NAC domain-containing protein 19
4dul_A2e-521617717168NAC domain-containing protein 19
4dul_B2e-521617717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G241500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0730131e-177AK073013.1 Oryza sativa Japonica Group cDNA clone:J033000B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574551.10.0protein FEZ
SwissprotQ9ZVH02e-95FEZ_ARATH; Protein FEZ
TrEMBLI1I7G40.0I1I7G4_BRADI; Uncharacterized protein
STRINGBRADI3G37067.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-97NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]