PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast02G021200.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 239aa MW: 26909.8 Da PI: 8.4426 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.4 | 8.9e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien s rqvtfskRr g++KKA+ELSvLCdaeva+i+fs++++lye++s Brast02G021200.2.p 9 KRIENPSSRQVTFSKRRGGLMKKAYELSVLCDAEVALIVFSPRDRLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 70.6 | 5e-24 | 77 | 170 | 5 | 98 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 ++ ++++++ e+ + +++ L +++e L+ R++lGe+L+++s++eLq+Le ++eksl +iR kK++l+ +q+++l++ke l+++n++Lr Brast02G021200.2.p 77 TSIQTAQQDIEKVKANAEGLSQKLEALEAYRRKFLGEKLDDCSFEELQSLEVKIEKSLHSIRRKKTQLFEDQLSKLRQKEMTLRKDNEDLR 167 33447889999*******************************************************************************9 PP K-box 96 kkl 98 k+ Brast02G021200.2.p 168 GKV 170 886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.628 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.03E-39 | 3 | 70 | No hit | No description |
PRINTS | PR00404 | 2.1E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.32E-31 | 3 | 77 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.1E-25 | 82 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.985 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MVRGKTQLKR IENPSSRQVT FSKRRGGLMK KAYELSVLCD AEVALIVFSP RDRLYEFASA 60 GMQKTLERYK ASTKDKTSIQ TAQQDIEKVK ANAEGLSQKL EALEAYRRKF LGEKLDDCSF 120 EELQSLEVKI EKSLHSIRRK KTQLFEDQLS KLRQKEMTLR KDNEDLRGKV PKDGENVDLQ 180 GKCKDVVDLT LVTSAPMIVA AAAAEEEENP PQAQPELNKD AMDVETELFI GLPGTNRS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 2e-21 | 3 | 71 | 2 | 70 | Myocyte-specific enhancer factor 2A |
3mu6_B | 2e-21 | 3 | 71 | 2 | 70 | Myocyte-specific enhancer factor 2A |
3mu6_C | 2e-21 | 3 | 71 | 2 | 70 | Myocyte-specific enhancer factor 2A |
3mu6_D | 2e-21 | 3 | 71 | 2 | 70 | Myocyte-specific enhancer factor 2A |
5f28_A | 3e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 3e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 3e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 3e-21 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269|PubMed:15144377, ECO:0000269|PubMed:17166135}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast02G021200.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF469308 | 0.0 | KF469308.1 Brachypodium distachyon MADS-box transcription factor 13 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001289808.1 | 1e-131 | MADS-box transcription factor 50-like | ||||
Swissprot | Q9XJ60 | 9e-97 | MAD50_ORYSJ; MADS-box transcription factor 50 | ||||
TrEMBL | I1HAD0 | 1e-129 | I1HAD0_BRADI; MADS-box transcription factor 13 | ||||
STRING | BRADI1G77020.1 | 1e-130 | (Brachypodium distachyon) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 4e-63 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast02G021200.2.p |