PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G250900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 316aa    MW: 34909.8 Da    PI: 5.5488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G250900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.2e-161663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Brast01G250900.1.p 16 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 63
                        788*******************************************97 PP

2Myb_DNA-binding50.64.6e-1669112146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E++l+v ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Brast01G250900.1.p  69 RGSFSQDEEDLIVSLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 112
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24866IPR009057Homeodomain-like
PROSITE profilePS5129418.4241163IPR017930Myb domain
SuperFamilySSF466894.49E-2912110IPR009057Homeodomain-like
SMARTSM007176.8E-131565IPR001005SANT/Myb domain
PfamPF002492.4E-141663IPR001005SANT/Myb domain
CDDcd001679.49E-121963No hitNo description
PROSITE profilePS5129425.15464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2567118IPR009057Homeodomain-like
SMARTSM007176.1E-1568116IPR001005SANT/Myb domain
PfamPF002492.8E-1469112IPR001005SANT/Myb domain
CDDcd001672.93E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGREAAACSS KPRLRRGLWS PEEDEKLYNH IIRYGVGCWS SVPKLAGLER CGKSCRLRWI  60
NYLRPDLKRG SFSQDEEDLI VSLHKILGNR WSQIASQLPG RTDNEIKNFW NSCIKKKLRQ  120
LGIDPATHKP LNDVDDRAAD SACDKQQLIP DQDDDGSHSC FNGSDVDLLL AAAAPHSPVC  180
SFDPLSVTNV PATMHSSGSL CEYGNSGAYT TGGDSSSNSN SAWSNVVEPL PHMDIFIRDT  240
EPYNHPFDPA KLFMSPMPAW QHSEQPHQQQ QQHPADQDVG GGGSASFPIR SLSRDLPESC  300
FQLARGALED EFDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121183108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast01G250900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925931e-149FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566757.21e-180myb-related protein Hv33
TrEMBLA0A0Q3J6J91e-179A0A0Q3J6J9_BRADI; Uncharacterized protein
STRINGBRADI2G40620.11e-180(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-74myb domain protein 86