PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Brast01G080300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 178aa MW: 19899.1 Da PI: 9.531 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.7 | 1.1e-07 | 16 | 60 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 +W++ Ed+ + a +++ + +W+++a++++ gRt+ + +++q Brast01G080300.1.p 16 PWSKAEDKAFESALVLFPEHtpgRWERVAARVP-GRTPREAWEHYQ 60 8*****************99999**********.***988777776 PP | |||||||
2 | Myb_DNA-binding | 47.3 | 4.7e-15 | 110 | 154 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE++l++d+ +++G g+W+ I+r +Rt+ q+ s+ qky Brast01G080300.1.p 110 PWSEEEHKLFLDGLEKYGRGDWRNISRFAVRTRTPTQVASHAQKY 154 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.171 | 9 | 67 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.09E-11 | 11 | 62 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-4 | 13 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-6 | 15 | 61 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.0E-6 | 16 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.39E-5 | 16 | 54 | No hit | No description |
PROSITE profile | PS51294 | 18.225 | 103 | 159 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.73E-17 | 105 | 160 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-11 | 107 | 157 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.7E-16 | 108 | 158 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.2E-11 | 110 | 153 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-12 | 110 | 154 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.09E-10 | 110 | 155 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MDSSCYSSHQ AAWGRPWSKA EDKAFESALV LFPEHTPGRW ERVAARVPGR TPREAWEHYQ 60 ALVADVDLIE RGAVDAPACW NDDGGTADAA AAARRAAGKA RGEERRRGIP WSEEEHKLFL 120 DGLEKYGRGD WRNISRFAVR TRTPTQVASH AQKYFIRQAN AATRDSKRKS IHDITTP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 7e-16 | 14 | 77 | 8 | 71 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Brast01G080300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003567296.1 | 1e-104 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 2e-53 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0Q3IYG4 | 1e-103 | A0A0Q3IYG4_BRADI; Uncharacterized protein | ||||
STRING | EMT13974 | 5e-89 | (Aegilops tauschii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 8e-47 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Brast01G080300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|