PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Brast01G071800.1.p

Organism

Brachypodium stacei

Taxonomic ID

1071399

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium

Family

MYB

Protein Properties

Length: 266aa MW: 28674.6 Da PI: 9.0206

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Brast01G071800.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.5	5.4e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +k +G g+W++ ++ g+ R++k+c++rw +yl Brast01G071800.1.p 14 KGAWTKEEDQRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	54.4	2.9e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T ++del+++++++lG++ W++Ia ++ gRt++++k++w+++ Brast01G071800.1.p 67 RGNFTDDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.0E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.693	9	61	IPR017930	Myb domain
SMART	SM00717	9.8E-14	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.05E-28	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	5.7E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.05E-11	16	61	No hit	No description
PROSITE profile	PS51294	27.647	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.4E-27	65	116	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-15	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	2.92E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 266 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG 120 MDPQTHRPIS AAAASFPSSS PAPAASRLAA SAAFSVVPAS MGFARPSPPS SDDGHSSSGG 180 SSDGGPRCPD LNLDLDLDLS MSLPPPKTPA VVSPTLTSHP QQQQSICLCY HLGVRNGEAC 240 GCKTAAPAGP RAFRYIRPLE EGQYI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-30	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Brast01G071800.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK355449	0.0	AK355449.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1020M13.
GenBank	AK361531	0.0	AK361531.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1142O19.
GenBank	AK361613	0.0	AK361613.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144P14.
GenBank	AK362279	0.0	AK362279.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003O24.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003564745.1	1e-148	myb-related protein 308
Swissprot	P81393	6e-91	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	2e-90	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	I1HTV8	1e-147	I1HTV8_BRADI; Uncharacterized protein
STRING	BRADI2G56520.1	1e-147	(Brachypodium distachyon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	6e-86	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Brast01G071800.1.p

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]