PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009151910.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 225aa MW: 26073.1 Da PI: 7.922 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52 | 1.6e-16 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v +G+g+W++I r+ g++R++k+c++rw +yl XP_009151910.1 17 KGLWTVEEDNILRDYVLTHGKGQWNRIVRKTGLKRCGKSCRLRWINYL 64 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 62.3 | 9.9e-20 | 70 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l XP_009151910.1 70 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 115 79********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.973 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.2E-30 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.5E-13 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-14 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.3E-23 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.29E-10 | 20 | 64 | No hit | No description |
PROSITE profile | PS51294 | 29.281 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-19 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-18 | 70 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.84E-14 | 72 | 115 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-27 | 72 | 119 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MRTRRRTEEE NHQEYKKGLW TVEEDNILRD YVLTHGKGQW NRIVRKTGLK RCGKSCRLRW 60 INYLSPNVNK GNFTEQEEDL IIRLHKLLGN RWSLIAKRVP GRTDNQVKNH WNTHLSKKIV 120 GDYSSAVKTT GEENYPPSLL ITAATTSCHH QQDKICEKSF EGLVSASYED KQKADLAHTN 180 DSSFYFKAGN NFDSSNAFWF NDDDDFEMNS FAMMDFASGD TGYCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-28 | 17 | 119 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves primordia. Becomes more prominent in developing trichome cells but disappears progressively when trichomes begin to initiate branches. {ECO:0000269|PubMed:15728674}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, stems and flowers (PubMed:11437443). Expressed in trichome cells and in leaf primordia (PubMed:9625690). {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:9625690}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009151910.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ292618 | 0.0 | HQ292618.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 0 (MYB0) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009151910.1 | 1e-171 | PREDICTED: trichome differentiation protein GL1 | ||||
Swissprot | P27900 | 1e-120 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | M4E955 | 1e-169 | M4E955_BRARP; Uncharacterized protein | ||||
STRING | Bra025311.1-P | 1e-170 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-123 | myb domain protein 0 |