PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009151830.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

ZF-HD

Protein Properties

Length: 100aa MW: 10692.9 Da PI: 8.0522

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009151830.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	107.4	8.2e-34	30	87	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geeg++aal+CaACgCHR+FHRre e+e XP_009151830.1 30 GVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGSVAALTCAACGCHRSFHRREIETE 87 79****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-35	1	97	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	5.6E-29	31	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	3.8E-28	32	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.8	33	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 100 aa Download sequence Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRG VRYGECQKNH AAAVGGYAVD GCREFMASNG 60 EEGSVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bra.18987	1e-170	bud\| flower\| silique

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009151830.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU953330	1e-169	EU953330.1 Zea mays clone 1399539 zinc finger homeodomain protein 1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009151830.1	1e-67	PREDICTED: mini zinc finger protein 2
Refseq	XP_009151831.1	1e-67	PREDICTED: mini zinc finger protein 2
Refseq	XP_009151833.1	1e-67	PREDICTED: mini zinc finger protein 2
Refseq	XP_013596447.1	1e-67	PREDICTED: mini zinc finger protein 2
Refseq	XP_013647450.1	1e-67	mini zinc finger protein 2
Refseq	XP_013705939.1	1e-67	mini zinc finger protein 2
Refseq	XP_022544006.1	1e-67	mini zinc finger protein 2
Refseq	XP_022562812.1	1e-67	mini zinc finger protein 2
Swissprot	Q9LJW5	3e-55	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A0D3DBF2	2e-66	A0A0D3DBF2_BRAOL; Uncharacterized protein
TrEMBL	A0A397Z972	2e-66	A0A397Z972_BRACM; Uncharacterized protein
TrEMBL	B6SKR5	2e-66	B6SKR5_MAIZE; Zinc finger homeodomain protein 1
TrEMBL	M4E9A6	2e-66	M4E9A6_BRARP; Uncharacterized protein
STRING	Bra025362.1-P	4e-67	(Brassica rapa)
STRING	Bo7g087070.1	4e-67	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	8e-51	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]