PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family STAT
Protein Properties Length: 671aa    MW: 75461.3 Da    PI: 4.7832
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149142.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT177.22.5e-552243341111
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldvvl+na+gqpv+kdv+vvasLlya+sg++vek++d eapLL+sydGvefs+ed+p+ ll+G+as+klkisq  skcd+rLf+ikfeip+  +y
  XP_009149142.1 224 LDVVLSNAIGQPVRKDVQVVASLLYANSGTPVEKTSDLEAPLLVSYDGVEFSAEDKPCTLLNGCASLKLKISQHYSKCDKRLFCIKFEIPNKGSY 318
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrs 111
                     pflea+++++rCisr+
  XP_009149142.1 319 PFLEAFTNQMRCISRT 334
                     **************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2007.3E-525149IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133851.0E-627149No hitNo description
SuperFamilySSF498993.64E-829166IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103384.33E-63568671No hitNo description
SuperFamilySSF555501.81E-10576638IPR000980SH2 domain
Gene3DG3DSA:3.30.505.101.0E-7576626IPR000980SH2 domain
PROSITE profilePS5000110.048579632IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MADGCALDTE KYSLLEDFNV DVEVEKQEFE TFSLCFWVYL LDSTTYPSTI IRQVHSDMSF  60
SAPFLVLDEN KKMILLPLTL LHKEAPDPVN TASWTEVPNV STTAEFPLQR WVHVGCEVSR  120
NYMRLYICGK MVGEKLLTSV MTNGTNSDNV RRVSLFSVGG DGYSVQGFIH CGEVLPSTVH  180
VNNHYTKDPP LWLSVEKPST CEVDEDGVWS IVGEKASCGM IFSLDVVLSN AIGQPVRKDV  240
QVVASLLYAN SGTPVEKTSD LEAPLLVSYD GVEFSAEDKP CTLLNGCASL KLKISQHYSK  300
CDKRLFCIKF EIPNKGSYPF LEAFTNQMRC ISRTGGDSVT PKRLSPLVEG VPSSNGASDS  360
SLSMKRIKLG EEKIPESEFE GGNGTSMAWG PQNQDEEEEE EEEDQSSTDS DNTEVRGSTG  420
SRRYTISDST IFKYCLGNLT ERSLIMKEIT NNAGDEEVSE FADQVSLYSG CSHHGYQIKM  480
ARKLIAEGTN AWILISRNYQ NVHWDNVVIE IEEHFMRIAK CSSRSLTHQD FELLRRICGC  540
YDYITQENFE KMWCWLFPVA TSISRGLING MWRSCSPKWI EGFVTKEEAE HSLQSQEPGT  600
FILRFPTSRS WPHPDAGSLV VTYVGRDFVI RHRLLAVDHI CDERYTDAKP LQDMLLAEPE  660
LSRLGRIVRS I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1361368LSMKRIKL
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009149142.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149142.10.0PREDICTED: uncharacterized protein LOC103872490 isoform X2
SwissprotB5X5610.0SHA_ARATH; SH2 domain-containing protein A
TrEMBLA0A397YWK80.0A0A397YWK8_BRACM; Uncharacterized protein
STRINGBo5g022370.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]