PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009146272.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 179aa MW: 20724.2 Da PI: 9.9556 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132.1 | 1.9e-41 | 63 | 138 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 C v++C+a+lseak+y+rrhkvCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk + XP_009146272.1 63 CLVDRCTANLSEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKIS 138 *************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 30.744 | 60 | 137 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.3E-31 | 61 | 124 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.31E-37 | 62 | 141 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-31 | 63 | 136 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MEGQRSQRWG YLKDKAIATS LAEEETENSM DGEEDDTGDE DKRKRVMERA RGPNTERVPL 60 RLCLVDRCTA NLSEAKQYYR RHKVCEVHAK ASSATVAGVK QRFCQQCSRF HELAEFDETK 120 RSCRRRLAGH NERRRKISGD SYGEGSGRRG VSLTQTQERN RIDMKLPMTN SPFKRPQIR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 8e-40 | 60 | 136 | 8 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the inflorescence apical meristem and young flowers. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00359 | DAP | Transfer from AT3G15270 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009146272.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ011610 | 1e-164 | AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5. | |||
GenBank | AJ242960 | 1e-164 | AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene). | |||
GenBank | AK118611 | 1e-164 | AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19. | |||
GenBank | BT003714 | 1e-164 | BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009146272.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 5 | ||||
Swissprot | Q9S758 | 6e-98 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A397ZH73 | 1e-130 | A0A397ZH73_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EEQ3 | 1e-130 | M4EEQ3_BRARP; Uncharacterized protein | ||||
STRING | Bra027265.1-P | 1e-131 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 1e-100 | squamosa promoter binding protein-like 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|