PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009142870.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 28005.6 Da PI: 9.3968 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.7 | 4.9e-31 | 24 | 73 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+ XP_009142870.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73 79***********************************************8 PP | |||||||
2 | K-box | 110.9 | 1.4e-36 | 95 | 188 | 7 | 100 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 s++ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL+lkeL++Le +Lek++ ++RskK+e+l+++ie++qk+e elq++n++Lr+k++e XP_009142870.1 95 PSVTEANTQYYQQESSKLRRQIRDIQNLNRHILGESLGSLNLKELKNLEGRLEKGIGRVRSKKHEMLVAEIEYMQKREIELQNDNMYLRSKINE 188 45899**************************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.1E-40 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.389 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.71E-43 | 17 | 90 | No hit | No description |
SuperFamily | SSF55455 | 1.96E-32 | 17 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.2E-26 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-32 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-25 | 100 | 186 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.732 | 102 | 192 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MEGGASDEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPSVTEA NTQYYQQESS KLRRQIRDIQ 120 NLNRHILGES LGSLNLKELK NLEGRLEKGI GRVRSKKHEM LVAEIEYMQK REIELQNDNM 180 YLRSKINERA GMQQQEASVI HQQGTVYESS SHQSEQYNRN YIPVNLLEPN QNSSDQNQPP 240 LQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-20 | 16 | 84 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bra.31684 | 3e-85 | silique |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009142870.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ973088 | 0.0 | JQ973088.1 Brassica juncea Shatterproof (SHP2b) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009142866.1 | 1e-179 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_009142867.1 | 1e-179 | PREDICTED: agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673080.1 | 1e-179 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673081.1 | 1e-179 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013673082.1 | 1e-179 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Refseq | XP_013691073.1 | 1e-179 | agamous-like MADS-box protein AGL5 | ||||
Refseq | XP_022574676.1 | 1e-179 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
Swissprot | P29385 | 1e-165 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
TrEMBL | A0A397ZD96 | 1e-178 | A0A397ZD96_BRACM; Uncharacterized protein | ||||
TrEMBL | B1PHV6 | 1e-178 | B1PHV6_BRANA; Shatterproof 2 | ||||
TrEMBL | M4CKI1 | 1e-178 | M4CKI1_BRARP; Uncharacterized protein | ||||
STRING | Bra004716.1-P | 1e-178 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.1 | 1e-154 | MIKC_MADS family protein |