PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142634.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 584aa    MW: 65889.9 Da    PI: 7.3286
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142634.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.64.7e-23115216198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF + + +
  XP_009142634.1 115 FVKILTASDTSTHGGFSVLRKHATEClppldmtQ--ATPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGH-Q 206
                     89****************************9543..445569************************************************644.8 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  XP_009142634.1 207 TGDLRVGVRR 216
                     8889***998 PP

2Auxin_resp97.42.1e-32242321183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t+++F v+Y+Pr   s+F+++v+k+++a+k+ + +GmRf+m+fe+e+s+er ++Gt+vg+ dl+p +Wp SkWrsL+
  XP_009142634.1 242 ASHAFNTTTMFVVLYKPRI--SQFIISVNKYMAAMKKGFGIGMRFRMRFEGEESPERIFTGTIVGTGDLSP-QWPASKWRSLQ 321
                     689***************8..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-39100245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.6E-37109231IPR015300DNA-binding pseudobarrel domain
CDDcd100178.58E-20114216No hitNo description
SMARTSM010191.8E-20115218IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97115218IPR003340B3 DNA binding domain
PfamPF023622.9E-21115216IPR003340B3 DNA binding domain
PfamPF065073.3E-29242321IPR010525Auxin response factor
PfamPF023093.6E-8458509IPR033389AUX/IAA domain
SuperFamilySSF542773.53E-14465549No hitNo description
PROSITE profilePS5174528.439473565IPR000270PB1 domain
PfamPF023099.0E-7518558IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MENVVDDQLY MELWKACAGP LVEVPRYDER VFYFPQGHME QLVASTNQRV VDKDIPVFNL  60
PPKILCRVLN VMLKAEHETD EVYAQITLQP EEDQSEPTSL DPPLTEPAKQ TVDSFVKILT  120
ASDTSTHGGF SVLRKHATEC LPPLDMTQAT PTQELVARDL HGYEWRFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDAFV FLRGHQTGDL RVGVRRLAKQ QSTMPASVIS SQSMHLGVLA  240
TASHAFNTTT MFVVLYKPRI SQFIISVNKY MAAMKKGFGI GMRFRMRFEG EESPERIFTG  300
TIVGTGDLSP QWPASKWRSL QVQWDESSTV QRPNKVSPWE IEPFLPSTLT TSPTQPYSKS  360
KRSRPIDPSV SEITGSPVAS NFLSRFPKSH EPSPSLKLLF QDPSSERNSN KTEAPATSCC  420
RLFGFDLKSK PASAPNPNDK QQLISVDSNN TGSAKCQDPN SSKDQKQQTS STRSRTKVQM  480
QGTAVGRAVD LTLLRSYDEL IRELEKMFEI EGELRTKDKW AIVFTDDEGD MMLVGDDPWD  540
EFCKMAKKLF IYSSDEVKKM SSKSLLDDEC TMVHLEPDQR TVKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-162334413355Auxin response factor 1
4ldw_A1e-162334413355Auxin response factor 1
4ldw_B1e-162334413355Auxin response factor 1
4ldx_A1e-162334413355Auxin response factor 1
4ldx_B1e-162334413355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009142634.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794760.0JN979476.1 Brassica rapa subsp. pekinensis auxin response factor 11 (ARF11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142634.10.0PREDICTED: auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLH9B4D70.0H9B4D7_BRARP; Auxin response factor
STRINGBra004530.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]