PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009138271.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 240aa MW: 27506.3 Da PI: 7.7891 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.4 | 4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 kri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+ly++ss XP_009138271.1 9 KRIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 82.8 | 7.6e-28 | 81 | 170 | 9 | 98 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ + +q+e+a Lk++++nLq+++R+++Ge+L+ Ls+++Lq+Le+qLe sl+ +R kK+++l+e+i+el + + +++en +L+kk+ XP_009138271.1 81 NPASELKFWQNEAAILKRQLHNLQENHRQMMGEELSGLSVEDLQKLENQLEMSLRDVRMKKEQMLVEEIKELNREGNLVHQENLELHKKV 170 678899**********************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.071 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.3E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.22E-43 | 2 | 73 | No hit | No description |
SuperFamily | SSF55455 | 5.62E-32 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-25 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.602 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGRGKIAIKR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYDFSSS 60 SMKSVIERYR DAKCDTNSEM NPASELKFWQ NEAAILKRQL HNLQENHRQM MGEELSGLSV 120 EDLQKLENQL EMSLRDVRMK KEQMLVEEIK ELNREGNLVH QENLELHKKV NLMHQQHMEL 180 HKKVSEVESV KSADKISLLT NGLDMGGNSS EHVHLQLSQP QQHDETSSKA IQLSYFSFIA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-19 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:17704216}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009138271.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT030046 | 0.0 | BT030046.1 Arabidopsis thaliana At3g57230 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009138271.1 | 1e-176 | PREDICTED: agamous-like MADS-box protein AGL16 | ||||
Refseq | XP_013738394.1 | 1e-176 | agamous-like MADS-box protein AGL16 | ||||
Refseq | XP_022571931.1 | 1e-176 | agamous-like MADS-box protein AGL16 | ||||
Swissprot | A2RVQ5 | 1e-147 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
TrEMBL | A0A078IH39 | 1e-175 | A0A078IH39_BRANA; BnaA03g51000D protein | ||||
TrEMBL | A0A397L3M6 | 1e-175 | A0A397L3M6_BRACM; Uncharacterized protein | ||||
TrEMBL | M4DMA6 | 1e-175 | M4DMA6_BRARP; Uncharacterized protein | ||||
STRING | Bra017638.1-P | 1e-175 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM530 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 1e-149 | AGAMOUS-like 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|