PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009137652.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NZZ/SPL

Protein Properties

Length: 266aa MW: 28812.8 Da PI: 7.5938

Description

NZZ/SPL family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009137652.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NOZZLE	266.1	1.4e-81	1	266	1	314
NOZZLE 1 matslffmstdqnsvrnpnellrntrlvvnssgeirte.tkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaa 94 ma+slffm dq npne+lrnt+lv n s ei te +++s gr pgs t++qk kk lrgmgva+ler +ieee k++v a g + XP_009137652.1 1 MAASLFFMPRDQ----NPNEFLRNTYLV-NDSSEIPTEpPQNSHGRIPGSETGNQKPKKQVLRGMGVARLERLRIEEEWKNMVLAQGGRGA---- 86 9********9....5******9.999**999****************************************999876.... PP NOZZLE 95 isntatrlpvpvdrgvvlqgfps.slgssrilcgg...vgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrldgdq 185 s +atr p d+gvvlqgfps g+ + +gg gsgq+ pv spwg v ts+ he ss++ pq+yn s + cd+c+k++r++ XP_009137652.1 87 -SPNATRSP---DPGVVLQGFPSyGTGGHNMSVGGytrNGSGQI---PVYSPWGVVGTST--HEPSSVPTPQVYNPSNIH-CDACYKRQRINE-- 169 .6789...*******768889999999444599998...9******98..*********99888.*****964.. PP NOZZLE 186 nnvvrsngggfskytmipppmngydeyllqsdhhqrsqgflydqriaraasvsaasasinpyfneatnltgsreefgsvlegnprngsrgvkeye 280 vr+ngggf + +l++d qrsqgf+yd+riar + ++as+ gs+eefgs prng++ vkey+ XP_009137652.1 170 --EVRANGGGFPH--------------FLPPD--QRSQGFFYDHRIARYPASPSAST-----------NQGSMEEFGSG---SPRNGTGDVKEYQ 232 ..47***64..............58899..**********984444443...........369**96...********* PP NOZZLE 281 ffpgkydervskvakvaslvgdcspn..tidlslkl 314 ffpg +++ v v+++vgdcsp+ tidl+lkl XP_009137652.1 233 FFPGSDGNK--SVSSVSTSVGDCSPDtsTIDLTLKL 266 87765..466799****9889***98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF08744	1.5E-81	3	266	IPR014855	Plant transcription factor NOZZLE

Sequence ? help Back to Top
Protein Sequence Length: 266 aa Download sequence Send to blast
MAASLFFMPR DQNPNEFLRN TYLVNDSSEI PTEPPQNSHG RIPGSETGNQ KPKKQVLRGM 60 GVARLERLRI EEEWKNMVLA QGGRGASPNA TRSPDPGVVL QGFPSYGTGG HNMSVGGYTR 120 NGSGQIPVYS PWGVVGTSTH EPSSVPTPQV YNPSNIHCDA CYKRQRINEE VRANGGGFPH 180 FLPPDQRSQG FFYDHRIARY PASPSASTNQ GSMEEFGSGS PRNGTGDVKE YQFFPGSDGN 240 KSVSSVSTSV GDCSPDTSTI DLTLKL

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during microsporogenesis and megasoprogenesis (PubMed:10465788). Expressed during ovule development (PubMed:25378179). {ECO:0000269\|PubMed:10465788, ECO:0000269\|PubMed:25378179}.
Uniprot	TISSUE SPECIFICITY: Expressed in flower buds (PubMed:10465788, PubMed:10500234). Not found in leaves, siliques and stems (PubMed:10465788). Detected in rosette leaves, stem tissue and seedlings (PubMed:10500234). {ECO:0000269\|PubMed:10465788, ECO:0000269\|PubMed:10500234}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator of sporocyte development (PubMed:10465788). Acts as an adapter-like transcriptional repressor recruiting TPL/TPR corepressors to inhibit TCP transcription factors (PubMed:25378179). Required for nucellus and embryo sac development (PubMed:10500234). Plays a central role in patterning both the proximal-distal and the adaxial-abaxial axes during ovule development (PubMed:12183381). Involved in establishing the prospective chalaza of the ovule and in controlling the cell number and the length of the funiculus, and is required for the development of the integuments (PubMed:10976054). Required, with BEL1, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). Involved in controlling stamen identity (PubMed:19726570). May also regulate the morphology of lateral organs by repressing auxin production (PubMed:18557819). {ECO:0000269\|PubMed:10465788, ECO:0000269\|PubMed:10500234, ECO:0000269\|PubMed:10976054, ECO:0000269\|PubMed:12183381, ECO:0000269\|PubMed:18557819, ECO:0000269\|PubMed:19726570, ECO:0000269\|PubMed:22786869, ECO:0000269\|PubMed:25378179}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009137652.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by the transcription factor AGAMOUS (PubMed:15254538). Regulated by ATXR3/SDG2 via chromatin methylation (PubMed:21037105). Triggered by TGA9 AND TGA10 in anthers (PubMed:20805327). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:20805327, ECO:0000269\|PubMed:21037105}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009137652.1	0.0	PREDICTED: protein SPOROCYTELESS-like isoform X1
Refseq	XP_009137653.1	0.0	PREDICTED: protein SPOROCYTELESS-like isoform X2
Swissprot	O81836	1e-75	SPL_ARATH; Protein SPOROCYTELESS
TrEMBL	A0A078JD17	0.0	A0A078JD17_BRANA; BnaA03g58770D protein
TrEMBL	M4DRB3	0.0	M4DRB3_BRARP; Uncharacterized protein
STRING	Bra019056.1-P	0.0	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13435	18	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G27330.1	5e-78	sporocyteless (SPL)

Publications ? help Back to Top
Armenta-Medina A,Huanca-Mamani W,Sanchez-León N,Rodríguez-Arévalo I,Vielle-Calzada JP Functional analysis of sporophytic transcripts repressed by the female gametophyte in the ovule of Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e76977 [PMID:24194852] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Zhao L, et al. Comparative expression profiling reveals gene functions in female meiosis and gametophyte development in Arabidopsis. Plant J., 2014. 80(4): p. 615-28 [PMID:25182975] Yuan L,Sundaresan V Spore formation in plants: sporocyteless and more. Cell Res., 2015. 25(1): p. 7-8 [PMID:25512340] Picó S,Ortiz-Marchena MI,Merini W,Calonje M Deciphering the Role of POLYCOMB REPRESSIVE COMPLEX1 Variants in Regulating the Acquisition of Flowering Competence in Arabidopsis. Plant Physiol., 2015. 168(4): p. 1286-97 [PMID:25897002] Mao Y, et al. Development of germ-line-specific CRISPR-Cas9 systems to improve the production of heritable gene modifications in Arabidopsis. Plant Biotechnol. J., 2016. 14(2): p. 519-32 [PMID:26360626] Rojas-Gracia P, et al. The parthenocarpic hydra mutant reveals a new function for a SPOROCYTELESS-like gene in the control of fruit set in tomato. New Phytol., 2017. 214(3): p. 1198-1212 [PMID:28134991] Zhao F, et al. Phosphorylation of SPOROCYTELESS/NOZZLE by the MPK3/6 Kinase Is Required for Anther Development. Plant Physiol., 2017. 173(4): p. 2265-2277 [PMID:28209842] Bi H,Fan W,Zhang P C4 Protein of Sweet Potato Leaf Curl Virus Regulates Brassinosteroid Signaling Pathway through Interaction with AtBIN2 and Affects Male Fertility in Arabidopsis. Front Plant Sci, 2017. 8: p. 1689 [PMID:29021807]