PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009137577.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 610aa    MW: 69163.4 Da    PI: 6.4662
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009137577.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.71.2e-24112213199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  XP_009137577.1 112 FTKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYKWKFKHIFRGQPRRHLLTTGWSTFVTSKKLVAGDTFVFL--RGE 202
                     89****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  XP_009137577.1 203 NGELRVGVRRA 213
                     999******97 PP

2Auxin_resp112.34.7e-37238316182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     a ha++t+s+F+v+Y+Pr+  s+F+++v+k+++a+++k+svGmRfkm+fe++ds+err+sGtvvgv+d++p +W++SkWrsL
  XP_009137577.1 238 ACHATQTRSMFTVYYKPRT--SQFIISVNKYLEAMNSKFSVGMRFKMRFEGDDSPERRFSGTVVGVQDCSP-HWKDSKWRSL 316
                     6899**************6..9*************************************************.********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.97E-39103241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-42106227IPR015300DNA-binding pseudobarrel domain
CDDcd100176.95E-21110212No hitNo description
PfamPF023621.3E-22112213IPR003340B3 DNA binding domain
SMARTSM010191.2E-24112214IPR003340B3 DNA binding domain
PROSITE profilePS5086312.816112214IPR003340B3 DNA binding domain
PfamPF065073.8E-33238316IPR010525Auxin response factor
PfamPF023093.2E-7478534IPR033389AUX/IAA domain
SuperFamilySSF542775.89E-12494574No hitNo description
PROSITE profilePS5174525.019498598IPR000270PB1 domain
PfamPF023091.8E-6542586IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MTIGEHMYEE LWKLSAGPLV DVPQAEERVY YFPQGHMEQL EASTQQDLNT MKPLFDLPPK  60
ILCRVMNVRL QAEKDTDEVY AQIMLMPEGT VDEPMSPDPS PPELQKPKFH SFTKVLTASD  120
TSTHGGFSVL RKHATECLPP LDMTQQTPTQ ELVAEDVHGY KWKFKHIFRG QPRRHLLTTG  180
WSTFVTSKKL VAGDTFVFLR GENGELRVGV RRANRQQSSM PSSVISSHSM HLGVLATACH  240
ATQTRSMFTV YYKPRTSQFI ISVNKYLEAM NSKFSVGMRF KMRFEGDDSP ERRFSGTVVG  300
VQDCSPHWKD SKWRSLIVNW DEPASFTRPD KVSPWEMEPF AASENVPQSV NKRARHVNEI  360
SALDVGVPSS NFWSSALTQS HEFAQSCITS QRNPPQNSDW PVSPYSTLNG QMVFPVEQKK  420
PETTTASCRL FGIDLMSSSL PAHEEKTAPM RPINITKPTL DSNADPKSEI SKLSEEKKQE  480
PAQASPKEVQ SKQINSSRSR TKVQMQGVPV GRAVDLTLIN GYVELIDDLE KLFDIEGELK  540
SRNQWEIVFT DDEGDMMLVG DDPWPEFCNM VKRIFIWSKE EVKKMTPGNQ LRILLTEVDT  600
TISKTENYSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-164234014355Auxin response factor 1
4ldw_A1e-164234014355Auxin response factor 1
4ldw_B1e-164234014355Auxin response factor 1
4ldx_A1e-164234014355Auxin response factor 1
4ldx_B1e-164234014355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.321390.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009137577.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794730.0JN979473.1 Brassica rapa subsp. pekinensis auxin response factor 9-1 (ARF9-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009137577.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A078IBW50.0A0A078IBW5_BRANA; Auxin response factor
STRINGBra013748.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9