PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009137454.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 25285.8 Da PI: 8.6806 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.2 | 4.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr gi+KKA ELSvLCda+va+iifs tgkl+e+ss XP_009137454.1 9 KKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 62.5 | 1.7e-21 | 88 | 172 | 14 | 98 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ + +l++L +e+e +++R+l GedLe L+l+eLq+Le+ Le++l+++ +kK e+l++qi+ l k+ el +en++Lr+++ XP_009137454.1 88 QQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGLNLEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV 172 455566899*************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.679 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.14E-35 | 2 | 69 | No hit | No description |
SuperFamily | SSF55455 | 2.35E-29 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.7E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-19 | 88 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.611 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000060 | Biological Process | protein import into nucleus, translocation | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010220 | Biological Process | positive regulation of vernalization response | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MAREKRRIKK IDNITARQVT FSKRRRGIFK KADELSVLCD ADVALIIFSA TGKLFEFSSS 60 RMKDILGRYN LHASNINKVM GQPSPYNQQV ENCNLSRLSQ EVEDKTKQLR KLRGEDLEGL 120 NLEELQRLEK MLESGLSRVS EKKGEFLMSQ ISSLEKRGSE LVDENRRLRE RVVTMEMAKT 180 MALKEAVETE SATTNVSSYD SGAPLEDDFS DTSLKLGLPS WE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-17 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-17 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 4 | 25 | KRRIKKIDNITARQVTFSKRRR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bra.22853 | 0.0 | flower| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During vegetative phase, expressed in the entire shoot apical meristem and in emerging leaf primordia. During floral transition, gradually detectable in the transitional shoot apex and young cauline leaves. Detected in the inflorescence meristem. Present throughout the tunica (superficial layers) of the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. At later stages of floral development, weakly expressed in the distal parts of stamens and carpels. Then restricted to pollen and the adaxial surface of the gynoecium. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in shoot apical meristems, including floral meristems. Also detected in stems, seedlings, leaves, flowers and siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:19656343}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009137454.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ906707 | 0.0 | JQ906707.1 Brassica napus clone AGL24-1 MADS-box protein AGL24 (AGL24) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009137453.1 | 1e-161 | PREDICTED: MADS-box protein AGL24-like isoform X1 | ||||
Refseq | XP_009137454.1 | 1e-161 | PREDICTED: MADS-box protein AGL24-like isoform X1 | ||||
Swissprot | O82794 | 1e-132 | AGL24_ARATH; MADS-box protein AGL24 | ||||
TrEMBL | A0A397L644 | 1e-156 | A0A397L644_BRACM; Uncharacterized protein | ||||
STRING | Bra019221.1-P | 1e-153 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24540.1 | 1e-122 | AGAMOUS-like 24 |