PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009137162.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 97aa MW: 11425.8 Da PI: 9.7942 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 118.4 | 2.7e-37 | 20 | 77 | 4 | 61 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 a+ cprCds+ntkfCyynnyslsqPry Ck+CrryWt+GG+lrn+P+Gg+ rk k+ XP_009137162.1 20 PARVCPRCDSDNTKFCYYNNYSLSQPRYSCKNCRRYWTHGGTLRNIPIGGSGRKTKRP 77 5789**************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-24 | 19 | 76 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 7.0E-33 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.876 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 24 | 60 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MDKLNVFVRG DNQVNEEKPP ARVCPRCDSD NTKFCYYNNY SLSQPRYSCK NCRRYWTHGG 60 TLRNIPIGGS GRKTKRPKID QPSAENQQFE VFHQWRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009137162.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC172878 | 1e-146 | AC172878.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH069E01, complete sequence. | |||
GenBank | AC241020 | 1e-146 | AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013741408.1 | 2e-60 | dof zinc finger protein DOF4.4-like | ||||
Swissprot | Q9SUA9 | 3e-41 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
TrEMBL | A0A078J093 | 4e-59 | A0A078J093_BRANA; BnaA03g58570D protein | ||||
STRING | Bra038789.1-P | 7e-60 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21050.1 | 1e-43 | Dof-type zinc finger domain-containing protein |