PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009136478.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 220aa MW: 25325.2 Da PI: 6.9304 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87 | 1.1e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rq+tfskRr+g+lKKA ELSvLCda+va i+fs++gk+ye++s XP_009136478.1 9 KRIENQTSRQITFSKRRKGLLKKALELSVLCDAQVAAIVFSQKGKIYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 54 | 7.1e-19 | 83 | 176 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLrkkle 99 +ee++ + l++e++ + ++ie Lq R+l+G+dL+s+s+ eL+++ q+eksl+ iRs+K ++ e++ +l+ +el +e +L++++e XP_009136478.1 83 QEERDVQDLKNEVTVMVNRIELLQLHCRKLMGQDLGSCSVDELNEITIQIEKSLTLIRSRKAKVHEEEVGKLKAEiagTRELVNERATLHEMFE 176 678899******************999*********************************************9863335777888888888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.16 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.9E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.36E-37 | 3 | 67 | No hit | No description |
SuperFamily | SSF55455 | 9.55E-30 | 3 | 70 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-18 | 83 | 175 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.99 | 88 | 181 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MVRGKIEIKR IENQTSRQIT FSKRRKGLLK KALELSVLCD AQVAAIVFSQ KGKIYEFASS 60 DMKKMMEQCE IYRSGYFHAE RLQEERDVQD LKNEVTVMVN RIELLQLHCR KLMGQDLGSC 120 SVDELNEITI QIEKSLTLIR SRKAKVHEEE VGKLKAEIAG TRELVNERAT LHEMFEEKPL 180 WMQSGSLESE NNALSSSAFE NMNISDVETD LFIGLPRRQV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-18 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 3e-18 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 3e-18 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 3e-18 | 1 | 66 | 1 | 66 | MEF2C |
6byy_A | 3e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_B | 3e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_C | 3e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6byy_D | 3e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6bz1_A | 4e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6bz1_B | 4e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6bz1_C | 4e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
6bz1_D | 4e-18 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009136478.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232542 | 3e-51 | AC232542.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH005L20, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009136477.1 | 1e-161 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_009136478.1 | 1e-161 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_009136479.1 | 1e-161 | PREDICTED: MADS-box protein AGL71-like | ||||
Refseq | XP_022572404.1 | 1e-161 | MADS-box protein AGL71-like | ||||
Swissprot | Q9FLH5 | 3e-69 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | A0A3P6ABR5 | 1e-148 | A0A3P6ABR5_BRACM; Uncharacterized protein | ||||
TrEMBL | M4D8Z7 | 1e-148 | M4D8Z7_BRARP; Uncharacterized protein | ||||
STRING | Bra012957.1-P | 1e-149 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 2e-72 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|