PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009136373.1 | ||||||||
Common Name | TT16a | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 240aa MW: 28114.7 Da PI: 6.8601 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81.2 | 6.7e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr g++KK +ELSvLCda + +i+fs tgkl ey+s XP_009136373.1 9 KRIENRTSRQVTFSKRRSGLIKKTHELSVLCDAHIGLIVFSATGKLTEYCS 59 79***********************************************96 PP | |||||||
2 | K-box | 60.9 | 5e-21 | 85 | 171 | 13 | 99 |
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +e+l+qe++ L++e+ +L+ qR + G dL s+ eL LeqqLe+s+ k+R++Knell +q+e+l +k ++l+ +n ++ ++l XP_009136373.1 85 GQEELYQEIEVLRRETCKLELRQRPYHGHDLASIPPHELDALEQQLEHSVLKVRERKNELLQQQLENLSRKRRMLEVDNSNMYRRLH 171 5789***************************************************************************99988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.782 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.27E-31 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.25E-43 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 3.0E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.8E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.0E-20 | 84 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.677 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGRGKIEIKR IENRTSRQVT FSKRRSGLIK KTHELSVLCD AHIGLIVFSA TGKLTEYCSD 60 PSKMPQLIER YLQTNGLRLP DPNDGQEELY QEIEVLRRET CKLELRQRPY HGHDLASIPP 120 HELDALEQQL EHSVLKVRER KNELLQQQLE NLSRKRRMLE VDNSNMYRRL HEHGTAMEFQ 180 QAGIETKPGE YQQFLEQVQY YNEHQQQQPP NSVLQLATLP SEIDPNYHLQ LAQPNLQNDN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-18 | 1 | 75 | 1 | 73 | MEF2C |
5f28_B | 2e-18 | 1 | 75 | 1 | 73 | MEF2C |
5f28_C | 2e-18 | 1 | 75 | 1 | 73 | MEF2C |
5f28_D | 2e-18 | 1 | 75 | 1 | 73 | MEF2C |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 152 | 157 | SRKRRM |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009136373.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU192028 | 0.0 | EU192028.1 Brassica napus MADS-box DNA-binding domain transcription factor (TT16.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009136371.1 | 1e-177 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X1 | ||||
Refseq | XP_009136373.1 | 1e-177 | PREDICTED: protein TRANSPARENT TESTA 16 isoform X3 | ||||
Swissprot | Q8RYD9 | 1e-137 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A3P5ZPI6 | 1e-175 | A0A3P5ZPI6_BRACM; Uncharacterized protein | ||||
TrEMBL | G8Z8Z6 | 1e-176 | G8Z8Z6_BRANA; MADS DNA domain binding transcription factor BnaA.TT16a | ||||
TrEMBL | G8Z900 | 1e-176 | G8Z900_BRACM; MADS DNA domain binding transcription factor BraA.TT16a | ||||
TrEMBL | M4D968 | 1e-176 | M4D968_BRARP; Uncharacterized protein | ||||
STRING | Bra013028.1-P | 1e-176 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-123 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 103860514 |