PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009135363.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 118aa MW: 13266.4 Da PI: 8.8983 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 123.1 | 1.4e-38 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C+kdC+++pyfp ++p kf ++h+++Ga v+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq +++++++ la XP_009135363.1 5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFSCIHRIYGAGDVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTHIQKTQTLLA 99 6********************************************************************************************99 PP DUF260 96 llkee 100 ++++e XP_009135363.1 100 KTQAE 104 99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.414 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.6E-38 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFSCIHRI YGAGDVSKML QQLPVQTRAE 60 AVESLSFEAK CRVEDPVYGC VGIISLLQTH IQKTQTLLAK TQAEIAVAQT KHSQHTNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009135363.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473847 | 1e-106 | AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds. | |||
GenBank | DQ056609 | 1e-106 | DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009135363.1 | 2e-84 | PREDICTED: LOB domain-containing protein 24-like | ||||
Swissprot | P59468 | 3e-71 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | A0A291LR10 | 4e-81 | A0A291LR10_BRARR; Transcription factor LBD23 | ||||
STRING | Bo3g065910.1 | 2e-79 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 1e-73 | LOB domain-containing protein 24 |