PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009133737.1
Common NameSOC1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24349.8 Da    PI: 9.6788
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009133737.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.72.1e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrng+lKKA+ELSvLCdaev++iifs++gklye++s
  XP_009133737.1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVSLIIFSPKGKLYEFAS 59
                    79***********************************************86 PP

2K-box93.92.7e-3177171498
           K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      s+k ++e+++++ ++e+a++ k+ie+L+ ++R+llGe+++s+s++eLqq+eqqLeks+k +R++K+++++eqi +l++kek+l  en++L +k+
  XP_009133737.1  77 VSSKPVSEENMQHFKHEAANMMKKIEQLEASKRKLLGEGIGSCSIEELQQIEQQLEKSVKCVRARKTQVFKEQIVQLKQKEKALAAENEKLAEKW 171
                     456669*************************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33382IPR002100Transcription factor, MADS-box
CDDcd002651.14E-41378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014866.9E-2984170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.2187177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVSLIIFSP KGKLYEFASS  60
NMQDTVDRYL RHTKDRVSSK PVSEENMQHF KHEAANMMKK IEQLEASKRK LLGEGIGSCS  120
IEELQQIEQQ LEKSVKCVRA RKTQVFKEQI VQLKQKEKAL AAENEKLAEK WGSHEIEVWS  180
NKNQESGRGD EDSSPSSEVE TQLFIGLPCS SRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-19172172MEF2C
5f28_B6e-19172172MEF2C
5f28_C6e-19172172MEF2C
5f28_D6e-19172172MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Rapidly up-regulated in apical meristems during the transition to flowering. Transiently expressed in inflorescence meristem. Re-appears in stage 3 flowers, in the central dome that later will develop into stamens and carpels. {ECO:0000269|PubMed:19656343}.
UniprotTISSUE SPECIFICITY: Widely expressed. Not found in the apical meristem of short-day grown plants in vegetative stage.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator active in flowering time control. May integrate signals from the photoperiod, vernalization and autonomous floral induction pathways. Can modulate class B and C homeotic genes expression. When associated with AGL24, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. {ECO:0000269|PubMed:10995392, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:19656343}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009133737.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by gibberellins, vernalization and under long-day conditions. Gradual increase during vegetative growth. Induced by AGL24 at the shoot apex at the floral transitional stage. Repressed by SVP during the early stages of flower development. Inhibited by AP1 in emerging floral meristems (PubMed:17428825, PubMed:18339670, PubMed:19656343). Repressed by SHL to prevent flowering (PubMed:25281686). {ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25281686}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5239960.0EF523996.1 Brassica rapa subsp. chinensis MADS-box protein AGL20 mRNA, complete cds.
GenBankJQ8459140.0JQ845914.1 Brassica rapa cultivar YTS-151 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459170.0JQ845917.1 Brassica juncea cultivar SEJ-2 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459180.0JQ845918.1 Brassica juncea cultivar Pusa Bahar MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459200.0JQ845920.1 Brassica juncea cultivar RH-30 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459210.0JQ845921.1 Brassica rapa cultivar Pusa Gold MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459250.0JQ845925.1 Brassica juncea cultivar BIO-902 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ8459320.0JQ845932.1 Brassica napus cultivar GSL-1 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.
GenBankJQ9067020.0JQ906702.1 Brassica napus clone SOC1-2 MADS-box protein AGL20/SOC1 (AGL20) mRNA, complete cds.
GenBankJQ9730930.0JQ973093.1 Brassica rapa cultivar Ragini MADS box transcription factor SOC1 variant 4 (SOC1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288813.11e-156MADS-box protein SOC1-like
RefseqNP_001302872.11e-156MADS-box protein SOC1-like
RefseqXP_009133735.11e-156PREDICTED: MADS-box protein SOC1-like isoform X2
RefseqXP_009133736.11e-156PREDICTED: MADS-box protein SOC1-like isoform X2
RefseqXP_009133737.11e-156PREDICTED: MADS-box protein SOC1-like isoform X2
RefseqXP_013734812.11e-156MADS-box protein SOC1-like isoform X2
RefseqXP_013734813.11e-156MADS-box protein SOC1-like isoform X2
RefseqXP_013734814.11e-156MADS-box protein SOC1-like isoform X2
SwissprotO646451e-140SOC1_ARATH; MADS-box protein SOC1
TrEMBLA5A3Z81e-154A5A3Z8_BRARC; MADS-box protein AGL20
TrEMBLI6SWH11e-154I6SWH1_BRAJU; MADS box transcription factor SOC1 variant 17
TrEMBLI6TN751e-154I6TN75_BRANA; MADS box transcription factor SOC1 variant 17
TrEMBLM4C8651e-154M4C865_BRARP; Uncharacterized protein
TrEMBLT1QFV31e-154T1QFV3_BRACM; MADS box transcription factor SOC1 variant 16
STRINGBra000393.1-P1e-155(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-117AGAMOUS-like 20
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Heidari B,Nemie-Feyissa D,Kangasjärvi S,Lillo C
    Antagonistic regulation of flowering time through distinct regulatory subunits of protein phosphatase 2A.
    PLoS ONE, 2013. 8(7): p. e67987
    [PMID:23976921]
  3. Mouhu K, et al.
    The Fragaria vesca homolog of suppressor of overexpression of constans1 represses flowering and promotes vegetative growth.
    Plant Cell, 2013. 25(9): p. 3296-310
    [PMID:24038650]
  4. Lei HJ, et al.
    Identification and characterization of FaSOC1, a homolog of SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 from strawberry.
    Gene, 2013. 531(2): p. 158-67
    [PMID:24055423]
  5. Fu J, et al.
    Photoperiodic control of FT-like gene ClFT initiates flowering in Chrysanthemum lavandulifolium.
    Plant Physiol. Biochem., 2014. 74: p. 230-8
    [PMID:24316581]
  6. Steinbach Y,Hennig L
    Arabidopsis MSI1 functions in photoperiodic flowering time control.
    Front Plant Sci, 2014. 5: p. 77
    [PMID:24639681]
  7. Preston JC,Jorgensen SA,Jha SG
    Functional characterization of duplicated Suppressor of Overexpression of Constans 1-like genes in petunia.
    PLoS ONE, 2014. 9(5): p. e96108
    [PMID:24787903]
  8. Berr A,Shafiq S,Pinon V,Dong A,Shen WH
    The trxG family histone methyltransferase SET DOMAIN GROUP 26 promotes flowering via a distinctive genetic pathway.
    Plant J., 2015. 81(2): p. 316-28
    [PMID:25409787]
  9. Leal Valentim F, et al.
    A quantitative and dynamic model of the Arabidopsis flowering time gene regulatory network.
    PLoS ONE, 2015. 10(2): p. e0116973
    [PMID:25719734]
  10. Ma X, et al.
    CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana.
    Plant Mol. Biol., 2015. 88(3): p. 287-99
    [PMID:25948280]
  11. Kang MY, et al.
    Negative regulatory roles of DE-ETIOLATED1 in flowering time in Arabidopsis.
    Sci Rep, 2015. 5: p. 9728
    [PMID:25962685]
  12. Wang C,Dehesh K
    From retrograde signaling to flowering time.
    Plant Signal Behav, 2015. 10(6): p. e1022012
    [PMID:26098376]
  13. Lee JH,Jung JH,Park CM
    INDUCER OF CBF EXPRESSION 1 integrates cold signals into FLOWERING LOCUS C-mediated flowering pathways in Arabidopsis.
    Plant J., 2015. 84(1): p. 29-40
    [PMID:26248809]
  14. Sri T,Mayee P,Singh A
    Sequence and expression variation in SUPPRESSOR of OVEREXPRESSION of CONSTANS 1 (SOC1): homeolog evolution in Indian Brassicas.
    Dev. Genes Evol., 2015. 225(5): p. 287-303
    [PMID:26276216]
  15. Lee JH,Park CM
    Integration of photoperiod and cold temperature signals into flowering genetic pathways in Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089373
    [PMID:26430754]
  16. Li M, et al.
    DELLA proteins interact with FLC to repress flowering transition.
    J Integr Plant Biol, 2016. 58(7): p. 642-55
    [PMID:26584710]
  17. Franks SJ, et al.
    Variation in the flowering time orthologs BrFLC and BrSOC1 in a natural population of Brassica rapa.
    PeerJ, 2015. 3: p. e1339
    [PMID:26644966]
  18. Liu B, et al.
    Interplay of the histone methyltransferases SDG8 and SDG26 in the regulation of transcription and plant flowering and development.
    Biochim. Biophys. Acta, 2016. 1859(4): p. 581-90
    [PMID:26854085]
  19. Liu XR, et al.
    Overexpression of an Orchid (Dendrobium nobile) SOC1/TM3-Like Ortholog, DnAGL19, in Arabidopsis Regulates HOS1-FT Expression.
    Front Plant Sci, 2016. 7: p. 99
    [PMID:26904066]
  20. Davin N, et al.
    Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants.
    Plant J., 2016. 86(5): p. 376-90
    [PMID:26952251]
  21. Del Olmo I, et al.
    Arabidopsis DNA polymerase ϵ recruits components of Polycomb repressor complex to mediate epigenetic gene silencing.
    Nucleic Acids Res., 2016. 44(12): p. 5597-614
    [PMID:26980282]
  22. Mahrez W, et al.
    BRR2a Affects Flowering Time via FLC Splicing.
    PLoS Genet., 2016. 12(4): p. e1005924
    [PMID:27100965]
  23. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  24. He L, et al.
    Maize OXIDATIVE STRESS2 Homologs Enhance Cadmium Tolerance in Arabidopsis through Activation of a Putative SAM-Dependent Methyltransferase Gene.
    Plant Physiol., 2016. 171(3): p. 1675-85
    [PMID:27208260]
  25. Alter P, et al.
    Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1.
    Plant Physiol., 2016. 172(1): p. 389-404
    [PMID:27457125]
  26. Xu C,Yu Y,Zhang Y,Li Y,Wei S
    Gibberellins are involved in effect of near-null magnetic field on Arabidopsis flowering.
    Bioelectromagnetics, 2017. 38(1): p. 1-10
    [PMID:27598690]
  27. Riboni M,Robustelli Test A,Galbiati M,Tonelli C,Conti L
    ABA-dependent control of GIGANTEA signalling enables drought escape via up-regulation of FLOWERING LOCUS T in Arabidopsis thaliana.
    J. Exp. Bot., 2016. 67(22): p. 6309-6322
    [PMID:27733440]
  28. Kong X,Luo X,Qu GP,Liu P,Jin JB
    Arabidopsis SUMO protease ASP1 positively regulates flowering time partially through regulating FLC stability .
    J Integr Plant Biol, 2017. 59(1): p. 15-29
    [PMID:27925396]
  29. Kapolas G, et al.
    APRF1 promotes flowering under long days in Arabidopsis thaliana.
    Plant Sci., 2016. 253: p. 141-153
    [PMID:27968983]
  30. Li H, et al.
    BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis.
    Mol Plant, 2017. 10(4): p. 545-559
    [PMID:28089951]
  31. Chen J, et al.
    Suppressor of Overexpression of CO 1 Negatively Regulates Dark-Induced Leaf Degreening and Senescence by Directly Repressing Pheophytinase and Other Senescence-Associated Genes in Arabidopsis.
    Plant Physiol., 2017. 173(3): p. 1881-1891
    [PMID:28096189]
  32. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  33. Nasim Z,Fahim M,Ahn JH
    Possible Role of MADS AFFECTING FLOWERING 3 and B-BOX DOMAIN PROTEIN 19 in Flowering Time Regulation of Arabidopsis Mutants with Defects in Nonsense-Mediated mRNA Decay.
    Front Plant Sci, 2017. 8: p. 191
    [PMID:28261246]
  34. Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK
    Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae.
    Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929
    [PMID:28812948]
  35. Zhang GZ, et al.
    Ectopic expression of UGT84A2 delayed flowering by indole-3-butyric acid-mediated transcriptional repression of ARF6 and ARF8 genes in Arabidopsis.
    Plant Cell Rep., 2017. 36(12): p. 1995-2006
    [PMID:29027578]
  36. Jamge S,Stam M,Angenent GC,Immink RGH
    A cautionary note on the use of chromosome conformation capture in plants.
    Plant Methods, 2017. 13: p. 101
    [PMID:29177001]
  37. Dotto M,Gómez MS,Soto MS,Casati P
    UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana.
    Plant Cell Environ., 2018. 41(6): p. 1394-1406
    [PMID:29447428]