PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009133733.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 250aa MW: 28747.7 Da PI: 9.3259 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.3 | 3e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k ienk+nrqvtfskRrng++KKA+ELSvLCdaeva+i+fss+gklye+ XP_009133733.1 9 KLIENKINRQVTFSKRRNGLMKKAYELSVLCDAEVALIVFSSRGKLYEFG 58 569*********************************************95 PP | |||||||
2 | K-box | 96.2 | 4.9e-32 | 75 | 171 | 3 | 99 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +s ++s e+ +++++qe++kLk+ +e+L r++RhllGedL+++slkeL Le+qLe +l++ R++K+++++e++e+l+kke++l ++nk+L+ k XP_009133733.1 75 RSLSNSRPEESTQNWCQEVTKLKSHYESLVRTNRHLLGEDLGKMSLKELLGLERQLEAALTTTRKRKTQVMIEEMEDLRKKERQLGDINKQLKIK 169 45556678899*********************************************************************************999 PP K-box 98 le 99 ++ XP_009133733.1 170 FD 171 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.534 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.92E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.45E-43 | 2 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-27 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.2E-30 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.329 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MGRGRVEMKL IENKINRQVT FSKRRNGLMK KAYELSVLCD AEVALIVFSS RGKLYEFGSV 60 GVERTIERYH RCYNRSLSNS RPEESTQNWC QEVTKLKSHY ESLVRTNRHL LGEDLGKMSL 120 KELLGLERQL EAALTTTRKR KTQVMIEEME DLRKKERQLG DINKQLKIKF DQAEGLAFKS 180 FQYLWPNTAA SVAGDPSNSE FPVQSSSVDC NTEPFLQIGF QQHYYVQGEG SSVSKSNIAC 240 KTNFVQDWVL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
5f28_A | 4e-20 | 1 | 88 | 1 | 81 | MEF2C |
5f28_B | 4e-20 | 1 | 88 | 1 | 81 | MEF2C |
5f28_C | 4e-20 | 1 | 88 | 1 | 81 | MEF2C |
5f28_D | 4e-20 | 1 | 88 | 1 | 81 | MEF2C |
6byy_A | 4e-20 | 1 | 88 | 1 | 81 | MEF2 CHIMERA |
6byy_B | 4e-20 | 1 | 88 | 1 | 81 | MEF2 CHIMERA |
6byy_C | 4e-20 | 1 | 88 | 1 | 81 | MEF2 CHIMERA |
6byy_D | 4e-20 | 1 | 88 | 1 | 81 | MEF2 CHIMERA |
6c9l_A | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 1 | 88 | 1 | 81 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 136 | 141 | TRKRKT |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Preferentially expressed in flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009133733.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ508409 | 0.0 | AJ508409.1 Brassica oleracea var. botrytis mRNA for MADS-box protein AGL6-a (agl6-a gene), short splice variant. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133733.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL6 isoform X2 | ||||
Refseq | XP_013740649.2 | 0.0 | agamous-like MADS-box protein AGL6 isoform X2 | ||||
Swissprot | P29386 | 1e-155 | AGL6_ARATH; Agamous-like MADS-box protein AGL6 | ||||
TrEMBL | A0A398A3R5 | 0.0 | A0A398A3R5_BRACM; Uncharacterized protein | ||||
STRING | Bra000392.1-P | 0.0 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-157 | AGAMOUS-like 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|