PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009133732.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 252aa MW: 28922 Da PI: 9.1642 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.3 | 3.1e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k ienk+nrqvtfskRrng++KKA+ELSvLCdaeva+i+fss+gklye+ XP_009133732.1 9 KLIENKINRQVTFSKRRNGLMKKAYELSVLCDAEVALIVFSSRGKLYEFG 58 569*********************************************95 PP | |||||||
2 | K-box | 94 | 2.4e-31 | 79 | 173 | 6 | 99 |
K-box 6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +++ e+++a +++qe++kLk+ +e+L r++RhllGedL+++slkeL Le+qLe +l++ R++K+++++e++e+l+kke++l ++nk+L+ k++ XP_009133732.1 79 NSRpEESTQACNWCQEVTKLKSHYESLVRTNRHLLGEDLGKMSLKELLGLERQLEAALTTTRKRKTQVMIEEMEDLRKKERQLGDINKQLKIKFD 173 33357888999*******************************************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.534 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.32E-43 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 4.58E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-27 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.9E-30 | 83 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.773 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 252 aa Download sequence Send to blast |
MGRGRVEMKL IENKINRQVT FSKRRNGLMK KAYELSVLCD AEVALIVFSS RGKLYEFGSV 60 GVERTIERYH RCYNRSLSNS RPEESTQACN WCQEVTKLKS HYESLVRTNR HLLGEDLGKM 120 SLKELLGLER QLEAALTTTR KRKTQVMIEE MEDLRKKERQ LGDINKQLKI KFDQAEGLAF 180 KSFQYLWPNT AASVAGDPSN SEFPVQSSSV DCNTEPFLQI GFQQHYYVQG EGSSVSKSNI 240 ACKTNFVQDW VL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 7e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 7e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 7e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 7e-20 | 1 | 69 | 1 | 69 | MEF2C |
6c9l_A | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 138 | 143 | TRKRKT |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Preferentially expressed in flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009133732.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ508409 | 0.0 | AJ508409.1 Brassica oleracea var. botrytis mRNA for MADS-box protein AGL6-a (agl6-a gene), short splice variant. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009133732.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL6 isoform X1 | ||||
Refseq | XP_022571764.1 | 0.0 | agamous-like MADS-box protein AGL6 isoform X1 | ||||
Swissprot | P29386 | 1e-153 | AGL6_ARATH; Agamous-like MADS-box protein AGL6 | ||||
TrEMBL | M4C864 | 0.0 | M4C864_BRARP; Uncharacterized protein | ||||
STRING | Bra000392.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-155 | AGAMOUS-like 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|