PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009132580.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 221aa MW: 25718 Da PI: 10.1028 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.8 | 6.6e-29 | 11 | 61 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rq+tfskRrng++KKA+ELSvLCda+va i+fs++g+lye+ss XP_009132580.1 11 KKIENRTSRQITFSKRRNGLFKKAHELSVLCDAQVAAIVFSQSGRLYEFSS 61 68***********************************************96 PP | |||||||
2 | K-box | 59.6 | 1.3e-20 | 92 | 173 | 16 | 97 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +l++e++ + k+i+ L+ qR+l+G++L+s+sl +Lq Le+q+eksl+ iRs+K el+ +q+ +l++ke+el ++ ++Lr++ XP_009132580.1 92 ELKKEMDIMVKKIDLLEVHQRKLMGQGLGSCSLAQLQGLETQIEKSLRIIRSRKAELYADQLLKLKEKERELLDQRRRLREE 173 5789***************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.5E-41 | 3 | 62 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.875 | 3 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-29 | 5 | 25 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.17E-42 | 5 | 75 | No hit | No description |
SuperFamily | SSF55455 | 1.31E-32 | 5 | 79 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.9E-27 | 12 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-29 | 25 | 40 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-29 | 40 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.265 | 90 | 181 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.1E-20 | 93 | 173 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MKMVRGKIEI KKIENRTSRQ ITFSKRRNGL FKKAHELSVL CDAQVAAIVF SQSGRLYEFS 60 SSEMEKTIER YVKFSPDYFV PGRPQVELYL LELKKEMDIM VKKIDLLEVH QRKLMGQGLG 120 SCSLAQLQGL ETQIEKSLRI IRSRKAELYA DQLLKLKEKE RELLDQRRRL REEEIRETLV 180 RPMLPVTLHT GKDETGSACR MSKHSSEVET DLFIGFPATR L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 5e-19 | 3 | 75 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009132580.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009132580.1 | 1e-159 | PREDICTED: MADS-box protein AGL71-like isoform X1 | ||||
Swissprot | Q9LT93 | 1e-103 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | A0A397ZUY7 | 1e-157 | A0A397ZUY7_BRACM; Uncharacterized protein | ||||
TrEMBL | M4EK37 | 1e-157 | M4EK37_BRARP; Uncharacterized protein | ||||
STRING | Bra029154.1-P | 1e-157 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.3 | 4e-95 | AGAMOUS-like 71 |