PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009131048.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 133aa MW: 15094.8 Da PI: 4.5019 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 56.7 | 5.9e-18 | 1 | 75 | 17 | 91 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 m k++ +n ++++da++++ ec +efi +++se+++ c++e+++ti+++ +l l lGf +y e++ + +++r XP_009131048.1 1 MTKIIKENVRVARDAQDLLIECCVEFINLISSESNEVCNKENKRTIAPEHVLKELQVLGFGEYGEEVYAAYEQHR 75 7899***********************************************************999876544444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.8E-28 | 1 | 116 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.86E-25 | 2 | 117 | IPR009072 | Histone-fold |
Pfam | PF00808 | 9.8E-16 | 2 | 53 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MTKIIKENVR VARDAQDLLI ECCVEFINLI SSESNEVCNK ENKRTIAPEH VLKELQVLGF 60 GEYGEEVYAA YEQHRYETIQ DSQRSVKMNT GAYMTEEEAA AEQQRMFAEA RARMNGGVSA 120 PQQLDTQQSS LQS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 6e-28 | 1 | 111 | 21 | 133 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bra.23849 | 0.0 | flower| root| silique |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009131048.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC241004 | 1e-86 | AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009131044.1 | 5e-95 | PREDICTED: protein Dr1 homolog isoform X1 | ||||
Refseq | XP_009131045.1 | 5e-95 | PREDICTED: protein Dr1 homolog isoform X1 | ||||
Refseq | XP_009131046.1 | 3e-95 | PREDICTED: protein Dr1 homolog isoform X2 | ||||
Refseq | XP_009131047.1 | 3e-95 | PREDICTED: protein Dr1 homolog isoform X2 | ||||
Refseq | XP_018512736.1 | 3e-95 | PREDICTED: protein Dr1 homolog isoform X2 | ||||
Swissprot | P49592 | 3e-77 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | M4CP38 | 1e-93 | M4CP38_BRARP; Uncharacterized protein | ||||
STRING | Bra005976.1-P | 2e-94 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23090.2 | 6e-67 | nuclear factor Y, subunit B13 |
Publications ? help Back to Top | |||
---|---|---|---|
|