PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009130119.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 258aa MW: 30552.6 Da PI: 8.6128 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 79.8 | 1.8e-25 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien + rqvtfskRr g++KKA+ELSvLCda + +i+fs tgkly + XP_009130119.1 25 KKIENRTARQVTFSKRRSGVIKKAHELSVLCDAHIGLIVFSATGKLYQHC 74 68*********************************************987 PP | |||||||
2 | K-box | 60.1 | 8.8e-21 | 99 | 183 | 11 | 95 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 + + e+ ++e++ L++e+ +L+ qR + G +L s+ eL LeqqLe+s+ kiR++Knel+ +q+e+l +k ++l+++n+++ XP_009130119.1 99 NDNREEFCHEIEVLRRETCKLELRQRLYRGHGLASIPPHELDGLEQQLEHSVLKIRQRKNELMQQQLENLSRKRRMLEDDNNNMY 183 5678999**************************************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.2E-38 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.515 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.82E-42 | 18 | 95 | No hit | No description |
SuperFamily | SSF55455 | 1.7E-30 | 18 | 107 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.1E-24 | 26 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-27 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.4E-19 | 99 | 186 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.142 | 102 | 192 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
MNQEEEKREN KKKRREMGRG KIEIKKIENR TARQVTFSKR RSGVIKKAHE LSVLCDAHIG 60 LIVFSATGKL YQHCTEPLTM PQLIDRYLQT NGLRLPDPND NREEFCHEIE VLRRETCKLE 120 LRQRLYRGHG LASIPPHELD GLEQQLEHSV LKIRQRKNEL MQQQLENLSR KRRMLEDDNN 180 NMYRWLHGHR ATTEFQQGGI ETKPGEYQQF LEQVQFYNDQ QQQPNSFLQL ATHPSEIDLN 240 YHLHLAQPNL QNDPMANI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 17 | 91 | 1 | 73 | MEF2C |
5f28_B | 2e-17 | 17 | 91 | 1 | 73 | MEF2C |
5f28_C | 2e-17 | 17 | 91 | 1 | 73 | MEF2C |
5f28_D | 2e-17 | 17 | 91 | 1 | 73 | MEF2C |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 10 | 14 | KKKRR |
2 | 168 | 173 | SRKRRM |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009130119.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM449990 | 0.0 | HM449990.1 Brassica napus cultivar DH12075 MADS-box DNA-binding domain transcription factor (TT16.3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001302876.1 | 0.0 | protein TRANSPARENT TESTA 16-like | ||||
Refseq | XP_009130118.1 | 0.0 | PREDICTED: protein TRANSPARENT TESTA 16-like isoform X1 | ||||
Swissprot | Q8RYD9 | 1e-129 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | A0A3P6AST2 | 0.0 | A0A3P6AST2_BRACM; Uncharacterized protein | ||||
STRING | Bra029365.1-P | 0.0 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-127 | MIKC_MADS family protein |