PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009127621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 285aa    MW: 33125.9 Da    PI: 5.4324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009127621.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-152067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++ q   g+W+ +a++ g++R +k+c++rw++yl
   XP_009127621.1 20 RGPWTLEEDTLLTNYILQNSEGRWNVVAKCAGLKRNGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.22.8e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009127621.1  73 RGNLSPQEQLLILDLHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1361567IPR017930Myb domain
SuperFamilySSF466891.65E-2817114IPR009057Homeodomain-like
SMARTSM007177.2E-121969IPR001005SANT/Myb domain
PfamPF002497.3E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-202174IPR009057Homeodomain-like
CDDcd001673.07E-82267No hitNo description
PROSITE profilePS5129424.47568122IPR017930Myb domain
SMARTSM007174.9E-1472120IPR001005SANT/Myb domain
PfamPF002495.0E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2275121IPR009057Homeodomain-like
CDDcd001677.92E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MENSMKKKTF TESEEVELRR GPWTLEEDTL LTNYILQNSE GRWNVVAKCA GLKRNGKSCR  60
LRWLNYLKPD IRRGNLSPQE QLLILDLHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQNPSNTYCC PQNNNNNNNS LLPPSQSYDS  180
MSKQTYTDIS GKNPGISNTD GSASSSTFMP DLMTVPHFMD HNTIIDSSMC YHEGNDQELG  240
GYIPGMEEYY MRNSDISTDC HVAEAYEDVT QDPMWNVDDV WQFRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-23171221105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves and flowers. {ECO:0000269|PubMed:19529828}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009127621.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756550.0KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127621.10.0PREDICTED: transcription factor MYB24-like
SwissprotQ9C9G71e-154MYB62_ARATH; Transcription factor MYB62
TrEMBLM4EYQ60.0M4EYQ6_BRARP; Uncharacterized protein
STRINGBra033948.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-156myb domain protein 62
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]