PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009125576.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 213aa MW: 24103.5 Da PI: 5.8082 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36.2 | 1.4e-11 | 99 | 142 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +W++ E++l++ + ++G+g+W++I+r + +Rt+ q+ s+ qk XP_009125576.1 99 PWSENEHKLFLIGLDRYGKGDWRSISRNVVVTRTPTQVASHAQK 142 8****************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.446 | 1 | 51 | IPR017877 | Myb-like domain |
SMART | SM00717 | 1.1E-5 | 2 | 53 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.17E-11 | 4 | 59 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.43E-4 | 6 | 51 | No hit | No description |
PROSITE profile | PS51294 | 16.237 | 92 | 148 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.46E-14 | 94 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.0E-14 | 95 | 147 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.1E-6 | 96 | 146 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-9 | 98 | 139 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.4E-9 | 99 | 142 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.36E-6 | 99 | 142 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MASSQWTRSE DKRFEEALVF FPEGSPNRWE RIADQLHKPV GEVREHYEAL VHDVFQIDSG 60 QVDVPDYIDD SAAAAGWDSA GQISFGTKHS EGERKRGTPW SENEHKLFLI GLDRYGKGDW 120 RSISRNVVVT RTPTQVASHA QKSFLRQNSV KKERKRSSIH DINTVDTSLA MPGSNMEWTG 180 QHESPVQTQQ QLVSEFGQEL TPGGHFEDFG FGM |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009125576.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189388 | 1e-177 | AC189388.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB053D06, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009125576.1 | 1e-158 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 1e-53 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | M4EJ15 | 1e-157 | M4EJ15_BRARP; Uncharacterized protein | ||||
STRING | Bra028780.1-P | 1e-157 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-124 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|