PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009115015.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 133aa MW: 15583.8 Da PI: 6.7866 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 36.3 | 7.3e-12 | 1 | 31 | 21 | 51 |
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51 +KKA EL vLCd+ + +iifs+++kly +ss XP_009115015.1 1 MKKARELFVLCDVPIGLIIFSQSDKLYSFSS 31 8****************************96 PP | |||||||
2 | K-box | 31.2 | 9.5e-12 | 60 | 131 | 13 | 82 |
K-box 13 kaeslqqe.lakLkkeienLqreqRhl.lGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 ++ s+++e + + +eienL+ ++ + G +L+ L++ +L + + qLe sl++ R++K el+++ ++lq+ XP_009115015.1 60 DHGSYCEEtKESMMREIENLKMNLQFYgGGHNLNLLTYDDLLRFQLQLECSLQNARARKFELMHQLHQTLQE 131 4445555515789********98554414689********************************99999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 13.582 | 1 | 33 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.76E-13 | 1 | 48 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.6E-10 | 1 | 29 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.539 | 62 | 133 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.6E-7 | 64 | 132 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048530 | Biological Process | fruit morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MKKARELFVL CDVPIGLIIF SQSDKLYSFS SQSTSMEKLI MRYQMAKEGH ATSVDSFHPD 60 HGSYCEETKE SMMREIENLK MNLQFYGGGH NLNLLTYDDL LRFQLQLECS LQNARARKFE 120 LMHQLHQTLQ ENR |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in bud pedicels, petals, anthers, style, ovary, seeds and embryos. {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00172 | DAP | Transfer from AT1G31140 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009115015.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009115015.1 | 8e-96 | PREDICTED: MADS-box protein GGM13 | ||||
Swissprot | Q9SA07 | 2e-50 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A3P5YJ51 | 5e-81 | A0A3P5YJ51_BRACM; Uncharacterized protein | ||||
STRING | Bo5g065750.1 | 3e-70 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16860 | 9 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31140.2 | 8e-53 | GORDITA |
Publications ? help Back to Top | |||
---|---|---|---|
|