PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009113584.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 220aa MW: 25219.6 Da PI: 9.7537 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.5e-31 | 10 | 59 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+ XP_009113584.1 10 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 59 79***********************************************8 PP | |||||||
2 | K-box | 59.4 | 1.5e-20 | 75 | 162 | 2 | 100 |
K-box 2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 +++s+ s++e +a+++qqe+akL+++i+++q++ s+keL+q+e++Lek++++iRskK+elll++ie+lqk+e el++e +Lr+ XP_009113584.1 75 DNTSTHSVQEINAAYYQQESAKLRQQIQTIQNS-----------NSVKELKQVENRLEKAISRIRSKKHELLLAEIENLQKREIELDNESIYLRT 158 56777889***********************87...........49************************************************* PP K-box 97 klee 100 k++e XP_009113584.1 159 KIAE 162 *986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.034 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.0E-42 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.34E-43 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 1.19E-33 | 3 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 4 | 58 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-26 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-33 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.077 | 70 | 166 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.6E-11 | 86 | 160 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MMGRGKIEIK RIENSTNRQV TFCKRRNGLL KKAYELSVLC DAEVALIVFS TRGRLYEYAN 60 NNIRSTIERY KKASDNTSTH SVQEINAAYY QQESAKLRQQ IQTIQNSNSV KELKQVENRL 120 EKAISRIRSK KHELLLAEIE NLQKREIELD NESIYLRTKI AEVERFQQHH HQMVSGTEMT 180 AIEVLASRNY FAHSIMTTGS GSGAGHGCSY SDPDKKIHLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_R | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_S | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_A | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_B | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_C | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_D | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_E | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_F | 7e-22 | 2 | 75 | 1 | 74 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bra.11473 | 0.0 | flower| silique |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269|PubMed:22176531, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009113584.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF856616 | 1e-173 | KF856616.1 UNVERIFIED: Brassica oleracea var. viridis MADS box protein-like (AGL11) mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009113584.1 | 1e-162 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 | ||||
Swissprot | Q38836 | 1e-129 | AGL11_ARATH; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A3P5Y0I3 | 1e-156 | A0A3P5Y0I3_BRACM; Uncharacterized protein | ||||
TrEMBL | M4F9Y1 | 1e-156 | M4F9Y1_BRARP; Uncharacterized protein | ||||
STRING | Bra037895.1-P | 1e-157 | (Brassica rapa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-132 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|