PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009111778.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 328aa MW: 37328.4 Da PI: 6.4399 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 179.5 | 8.8e-56 | 20 | 146 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL++kv ++ +++ +i evd++kvePwdLp k+k +ekewyfF+ rd+ky+tg r+nratk+gyWkatgkdke+++ XP_009111778.1 20 LPPGFRFHPTDEELISYYLRPKVLNTFFSA-IAIGEVDLNKVEPWDLPWKAKIGEKEWYFFCVRDRKYPTGLRTNRATKAGYWKATGKDKEIFK- 112 79*************************999.88***************98999*****************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 ++ vg+kktLvfykgrapkg+kt+Wvmheyrle XP_009111778.1 113 EKCIVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146 9999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.18E-62 | 16 | 170 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.892 | 20 | 170 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.2E-30 | 21 | 145 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0042542 | Biological Process | response to hydrogen peroxide | ||||
GO:0051091 | Biological Process | positive regulation of sequence-specific DNA binding transcription factor activity | ||||
GO:1900057 | Biological Process | positive regulation of leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 328 aa Download sequence Send to blast |
MDGEVSRTWE ITEDSEQIDL PPGFRFHPTD EELISYYLRP KVLNTFFSAI AIGEVDLNKV 60 EPWDLPWKAK IGEKEWYFFC VRDRKYPTGL RTNRATKAGY WKATGKDKEI FKEKCIVGMK 120 KTLVFYKGRA PKGVKTNWVM HEYRLEGKYA IDNNPKTAKN EWVISRIFQK HADGKKMHIS 180 SLMKLGSGIN HIEPVGLPPL MDSSPYLKSG GGDTFAGSLS HVTCFSDQTT EDKSHLSESR 240 DECNFTMFGS SSTHLMIPNI GSILHSDPMI MQDNSPILKI MLDSEETQFK KDLQDFSTSE 300 NELTASSWHG HDISGSAAPV EMDCFWNF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-54 | 12 | 176 | 9 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-54 | 12 | 176 | 9 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-54 | 12 | 176 | 9 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-54 | 12 | 176 | 9 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-54 | 12 | 176 | 12 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-54 | 12 | 176 | 9 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-54 | 12 | 176 | 9 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269|PubMed:21303842}. | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:21303842}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009111778.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF738272 | 0.0 | KF738272.1 Brassica napus NAC transcription factor 59 (NAC59.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009111778.1 | 0.0 | PREDICTED: NAC domain-containing protein 59-like | ||||
Refseq | XP_013660809.1 | 0.0 | NAC domain-containing protein 59-like isoform X1 | ||||
Swissprot | Q9LJW3 | 1e-167 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
TrEMBL | A0A3P5XUK5 | 0.0 | A0A3P5XUK5_BRACM; Uncharacterized protein | ||||
TrEMBL | M4F567 | 0.0 | M4F567_BRARP; Uncharacterized protein | ||||
STRING | Bra036223.1-P | 0.0 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM400 | 28 | 174 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G29035.1 | 1e-169 | NAC domain containing protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|