PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009111614.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

ZF-HD

Protein Properties

Length: 98aa MW: 10568.8 Da PI: 8.2928

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009111614.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	103.3	1.6e-32	30	85	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt++al+CaACgCHR+FHRre+e XP_009111614.1 30 GVRYGECQKNHAAAVGGYAVDGCREFMASNGEEGTVSALTCAACGCHRSFHRRETE 85 79***************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-32	1	95	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.2E-29	31	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	7.8E-28	32	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.888	33	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MRKRQVVLRR ASPEEPSRSS STASSRMVRG VRYGECQKNH AAAVGGYAVD GCREFMASNG 60 EEGTVSALTC AACGCHRSFH RRETEVVCDC ESPPSTGN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Bra.18987	2e-87	bud\| flower\| silique

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009111614.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC155348	1e-165	AC155348.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' chromosome Cytogenetic chromosome 1 clone KBrH097M21, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009111614.1	6e-66	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_013691657.1	6e-66	mini zinc finger protein 2
Swissprot	Q9LJW5	9e-49	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A078G3M7	1e-64	A0A078G3M7_BRANA; BnaA09g02420D protein
TrEMBL	A0A397XQJ2	1e-64	A0A397XQJ2_BRACM; Uncharacterized protein
TrEMBL	M4FD69	1e-64	M4FD69_BRARP; Uncharacterized protein
STRING	Bra039039.1-P	2e-65	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-47	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]