PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009105011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 256aa MW: 30205.3 Da PI: 8.3134 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 97.9 | 4.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g++KKA+E+SvLCdaeva+++fs++gkl+eys+ XP_009105011.1 9 KRIENKINRQVTFSKRRAGLMKKAHEISVLCDAEVALVVFSHKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 107.4 | 1.7e-35 | 77 | 174 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++ + e+ + +++ e+++Lk++ie L+r+qRh+lGedL+ +s keLq+LeqqL+++lk+iRs+Kn+l++++i+elq+kek++qe+n +L+k+ XP_009105011.1 77 ERQLIAPESDSNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSSKELQNLEQQLDTALKHIRSRKNQLMYDSINELQRKEKAIQEQNSMLSKQ 171 5566666677789********************************************************************************** PP K-box 98 lee 100 ++e XP_009105011.1 172 IKE 174 987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.127 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.64E-42 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.57E-34 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.0E-30 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.812 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLMK KAHEISVLCD AEVALVVFSH KGKLFEYSTD 60 SCMEKILERY ERYSYAERQL IAPESDSNTN WSMEYNRLKA KIELLERNQR HYLGEDLQAM 120 SSKELQNLEQ QLDTALKHIR SRKNQLMYDS INELQRKEKA IQEQNSMLSK QIKEREKVLR 180 AQQEQWDEQN HGHNMPPPPP PQQHQIQHPY MLSHQPSPFL NMGGLYQEED QMTMRRNDLD 240 LSLEPVYNCN LGCFAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in floral primordia and is maintained at a maximal level at the floral bud stage of arrest. {ECO:0000269|PubMed:18332227}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_009105011.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ505845 | 0.0 | AJ505845.1 Brassica oleracea var. botrytis mRNA for MADS-box protein AP1-a. | |||
GenBank | BOU67452 | 0.0 | U67452.1 Brassica oleracea homeotic protein boi2AP1 (Boi2AP1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009105010.1 | 0.0 | PREDICTED: floral homeotic protein APETALA 1 A isoform X1 | ||||
Refseq | XP_009105011.1 | 0.0 | PREDICTED: floral homeotic protein APETALA 1 A isoform X2 | ||||
Swissprot | B4YPW6 | 0.0 | AP1A_BRAOA; Floral homeotic protein APETALA 1 A | ||||
Swissprot | Q8GTF5 | 0.0 | AP1A_BRAOB; Floral homeotic protein APETALA 1 A | ||||
Swissprot | Q96356 | 0.0 | 2AP1_BRAOT; Floral homeotic protein APETALA 1-2 | ||||
TrEMBL | A0A397YYU3 | 0.0 | A0A397YYU3_BRACM; Uncharacterized protein | ||||
STRING | Bo6g095760.1 | 0.0 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-164 | MIKC_MADS family protein |