Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 28.7 | 2.2e-09 | 164 | 197 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yp ++++ LA+++gL+++q+ +WF N+R ++
XP_013635325.1 164 WPYPPEQQKLALAESTGLDQKQINNWFINQRXRH 197
58*****************************986 PP
|
2 | ELK | 35.8 | 1.7e-12 | 117 | 138 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK qLlrKYsgy gsLkqEF+
XP_013635325.1 117 ELKGQLLRKYSGYXGSLKQEFM 138
9********************8 PP
|
Publications
? help Back to Top |
- Zhang XL,Yang ZP,Zhang J,Zhang LG
Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana. Int J Mol Sci, 2013. 14(7): p. 14872-91 [PMID:23863694] - Liu C, et al.
Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] - Simonini S,Kater MM
Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] - Scofield S,Dewitte W,Murray JA
STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] - Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] - Chen C, et al.
Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] - Lee JE,Lampugnani ER,Bacic A,Golz JF
SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] - Ckurshumova W,Berleth T
Overcoming recalcitrance - Auxin response factor functions in plant regeneration. Plant Signal Behav, 2015. 10(7): p. e993293 [PMID:26098229] - Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development. Plant Cell Physiol., 2015. 56(9): p. 1855-66 [PMID:26220906] - Rast-Somssich MI, et al.
Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] - Landrein B, et al.
Mechanical stress contributes to the expression of the STM homeobox gene in Arabidopsis shoot meristems. Elife, 2015. 4: p. e07811 [PMID:26623515] - Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J
Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity. Plant Mol. Biol., 2016. 91(1-2): p. 37-51 [PMID:26826012] - Shi B, et al.
Two-Step Regulation of a Meristematic Cell Population Acting in Shoot Branching in Arabidopsis. PLoS Genet., 2016. 12(7): p. e1006168 [PMID:27398935] - Lee HG,Choi YR,Seo PJ
Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] - Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] - Singh S, et al.
Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] - Lee HG,Choi YR,Seo PJ
Erratum to "Increased STM expression is associated with drought tolerance in Arabidopsis" [J. Plant Physiol. 201 (2016) 79-84]. J. Plant Physiol., 2018. 228: p. 218 [PMID:28456397] - Xue T, et al.
ARGONAUTE10 Inhibits In Vitro Shoot Regeneration Via Repression of miR165/166 in Arabidopsis thaliana. Plant Cell Physiol., 2017. 58(10): p. 1789-1800 [PMID:29016889] - Dolzblasz A, et al.
Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317] - Scofield S, et al.
Coordination of meristem and boundary functions by transcription factors in the SHOOT MERISTEMLESS regulatory network. Development, 2018. [PMID:29650590] - Liu L, et al.
FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis. Cell Rep, 2018. 23(6): p. 1879-1890 [PMID:29742441] - Chung Y, et al.
Auxin Response Factors promote organogenesis by chromatin-mediated repression of the pluripotency gene SHOOTMERISTEMLESS. Nat Commun, 2019. 10(1): p. 886 [PMID:30792395]
|