PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013634618.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 277aa MW: 32124 Da PI: 7.66 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162 | 2.3e-50 | 16 | 140 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + ee+ewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v+s + XP_013634618.1 16 LPGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVEENEWYFFCMRGRKYKNSVRPNRVTGSGFWKATGIDKPVYS-N 108 59***************************.99***************77777999**************************************.9 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 vglkk+Lv+y g+a kg+kt+W+mhe+rl XP_013634618.1 109 LDCVGLKKSLVYYLGSAGKGSKTNWMMHEFRL 140 999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 53.661 | 15 | 164 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 4.05E-56 | 16 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.2E-26 | 17 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 277 aa Download sequence Send to blast |
MSGEGKDHEE EDEAKLPGFR FHPTDEELLG YYLRRKVENK PIKLELIKQI DIYKFDPWDL 60 PRVSSVEENE WYFFCMRGRK YKNSVRPNRV TGSGFWKATG IDKPVYSNLD CVGLKKSLVY 120 YLGSAGKGSK TNWMMHEFRL PSTAKSESPT QQAEVWTLCR IFKRVTHHRN PTTLQPNRRP 180 VITLTDSCSK TSSLDSDHTS HHVVESLSHK LHEPQRQPQT QNPYWNQLTT VGFNQPTYTC 240 HDNNLVNLWN INGEDFIGEP ASWDELRSVI DGNTNHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-52 | 17 | 164 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-52 | 17 | 164 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-52 | 17 | 164 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-52 | 17 | 164 | 19 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swm_B | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swm_C | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swm_D | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swp_A | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swp_B | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swp_C | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
3swp_D | 2e-52 | 17 | 164 | 22 | 168 | NAC domain-containing protein 19 |
4dul_A | 2e-52 | 17 | 164 | 19 | 165 | NAC domain-containing protein 19 |
4dul_B | 2e-52 | 17 | 164 | 19 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bol.15819 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013634618.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352673 | 0.0 | AK352673.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-06-P15. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013634618.1 | 0.0 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Refseq | XP_013634619.1 | 0.0 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Refseq | XP_013634620.1 | 0.0 | PREDICTED: transcription factor JUNGBRUNNEN 1-like | ||||
Refseq | XP_013688681.1 | 0.0 | transcription factor JUNGBRUNNEN 1 | ||||
Refseq | XP_022569055.1 | 0.0 | transcription factor JUNGBRUNNEN 1-like | ||||
Swissprot | Q9SK55 | 1e-167 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A078FK90 | 0.0 | A0A078FK90_BRANA; BnaC04g48620D protein | ||||
TrEMBL | A0A0D3C5X3 | 0.0 | A0A0D3C5X3_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6CR22 | 0.0 | A0A3P6CR22_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g192870.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 1e-158 | NAC domain containing protein 42 |