PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013628777.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 183aa MW: 20785.1 Da PI: 9.8113 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 64.8 | 8.9e-21 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krie+ks rqvtf+kRrng++ KA LSvLC+ vav+i+ss gk+y XP_013628777.1 9 KRIEDKSSRQVTFCKRRNGLIEKARQLSVLCGSSVAVLIVSSIGKVYS 56 79********************************************95 PP | |||||||
2 | K-box | 24.5 | 1.1e-09 | 82 | 152 | 16 | 86 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 l+++ ++ + +e L++ qR+l ++++++++ L +Le+q +++l+ R++K+el+++ ++ q+k+ + XP_013628777.1 82 DLTEKTQNYLSLNELLETVQRKLEAANVDNITVQSLISLEEQSKTALSLTRARKTELMMQLVKSFQEKMGK 152 4555566666678999999999********************************************99755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 27.249 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-30 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.93E-25 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-20 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-21 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.046 | 80 | 175 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MGRRKVEIKR IEDKSSRQVT FCKRRNGLIE KARQLSVLCG SSVAVLIVSS IGKVYSSSSG 60 DSMAKILKHY EVQHADKLKT LDLTEKTQNY LSLNELLETV QRKLEAANVD NITVQSLISL 120 EEQSKTALSL TRARKTELMM QLVKSFQEKM GKEKEFLETE DERAMLLEYS SGSNLRETLP 180 LLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 2e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 2e-15 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 2e-15 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the negative regulation of flowering time in short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering, particularly in the cv. Landsberg erecta background. In non-inductive photoperiods (e.g. short days), required for flowering through VIL2-mediated maintenance of the epigenetically repressed state of MAF5 via H3K9me2 and plant homeodomain / polycomb repressive complex 2 (PHD-PRC2)-dependent H3K27me3. {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:18798874, ECO:0000269|PubMed:18852898, ECO:0000269|PubMed:20837520, ECO:0000269|PubMed:21150261, ECO:0000269|PubMed:21175890, ECO:0000269|PubMed:21398257, ECO:0000269|PubMed:22378382}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013628777.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by vernalization. Repressed by VIL2, AGL6, CLF, EMF2 and FIE via epigenetic chromatin H3K27me3 and H3K9me2 regulation during the vegetative development. {ECO:0000269|PubMed:12724541}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013628777.1 | 1e-129 | PREDICTED: protein MADS AFFECTING FLOWERING 5-like isoform X5 | ||||
Swissprot | Q683D7 | 3e-81 | MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5 | ||||
TrEMBL | A0A0D3BEW4 | 1e-123 | A0A0D3BEW4_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g100540.1 | 1e-124 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65050.1 | 3e-75 | AGAMOUS-like 31 |