PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013627225.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 240aa MW: 26733 Da PI: 5.6543 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 39.8 | 1e-12 | 15 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed +lvd + G +W+ +++ g++R++k+c++rw +yl XP_013627225.1 15 KGPWTADEDGKLVDFLRTRGASggwCWRDVPKLAGLKRCGKSCRLRWTNYL 65 79******************99***************************97 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.9e-18 | 71 | 115 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg +++eE +l +d+++qlG++ W++Ia++++ gRt++++k++w+++ XP_013627225.1 71 RGLFSEEEIQLVIDLHAQLGNR-WSKIAAELP-GRTDNDIKNYWNTH 115 7889******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-17 | 6 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 11.037 | 10 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.76E-24 | 12 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-6 | 14 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.5E-11 | 15 | 65 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.17E-5 | 17 | 65 | No hit | No description |
PROSITE profile | PS51294 | 27.155 | 66 | 120 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-26 | 69 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-17 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.6E-16 | 71 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.60E-13 | 74 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGGRKPCCDE VGLRKGPWTA DEDGKLVDFL RTRGASGGWC WRDVPKLAGL KRCGKSCRLR 60 WTNYLRPDLK RGLFSEEEIQ LVIDLHAQLG NRWSKIAAEL PGRTDNDIKN YWNTHIKRKL 120 IRMGIDPNTH SPFDQQKVKH EKEETTLVNG QDPPHQAEAP VGLQNDTSAG NLTHLADVDG 180 DNIQPWSFLM ENNGGGCSSV GELTMLLSGD ITSSCSSSSS LWLKYGELGY EDLELGCFDD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-27 | 13 | 120 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00577 | DAP | Transfer from AT5G62320 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013627225.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013627224.1 | 1e-179 | PREDICTED: protein ODORANT1 | ||||
Refseq | XP_013627225.1 | 1e-179 | PREDICTED: protein ODORANT1 | ||||
Swissprot | Q50EX6 | 5e-69 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A0D3BFT8 | 1e-177 | A0A0D3BFT8_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g107740.1 | 1e-178 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62320.1 | 1e-127 | myb domain protein 99 |
Publications ? help Back to Top | |||
---|---|---|---|
|