PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013626799.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 232aa MW: 26424.9 Da PI: 9.8713 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.9 | 1.7e-30 | 10 | 59 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+EL vLCdaeva+i+fs++g+lyey+ XP_013626799.1 10 KRIENSTNRQVTFCKRRNGLLKKAYELAVLCDAEVALIVFSTRGRLYEYA 59 79***********************************************8 PP | |||||||
2 | K-box | 98.4 | 1e-32 | 78 | 174 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++ s++e +a+++qqe+akL+++i+++q+++R+l+G++L+ L++keL+q+e++Lek++++iRskK+elll++ie+l k+e +l++e +Lr+k+ XP_013626799.1 78 ANTHSVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSALNVKELKQVENRLEKAISRIRSKKHELLLAEIENLHKREIKLDNESIYLRTKI 172 455569999*************************************************************************************9 PP K-box 99 ee 100 +e XP_013626799.1 173 AE 174 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.1E-40 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.347 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.19E-32 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.61E-41 | 3 | 76 | No hit | No description |
PRINTS | PR00404 | 1.9E-32 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 4 | 58 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-26 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-32 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-32 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.7E-24 | 87 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.865 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MIGRGKIEIK RIENSTNRQV TFCKRRNGLL KKAYELAVLC DAEVALIVFS TRGRLYEYAN 60 DNIRATFERY KNSSSGNANT HSVQEINAAY YQQESAKLRQ QIQTIQNSNR NLMGDSLSAL 120 NVKELKQVEN RLEKAISRIR SKKHELLLAE IENLHKREIK LDNESIYLRT KIAEVERFQQ 180 HHHQMVSGTE MTAIEALASR NYFAHNIMTI GSGSGAGHGC SYSDPDKKTH LG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-20 | 2 | 87 | 1 | 89 | MEF2C |
5f28_B | 3e-20 | 2 | 87 | 1 | 89 | MEF2C |
5f28_C | 3e-20 | 2 | 87 | 1 | 89 | MEF2C |
5f28_D | 3e-20 | 2 | 87 | 1 | 89 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269|PubMed:22176531, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013626799.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013626799.1 | 1e-171 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
Swissprot | Q38836 | 1e-134 | AGL11_ARATH; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A398A627 | 1e-162 | A0A398A627_BRACM; Uncharacterized protein | ||||
TrEMBL | M4C918 | 1e-162 | M4C918_BRARP; Uncharacterized protein | ||||
STRING | Bra000696.1-P | 1e-163 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4994 | 22 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-137 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|