PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013626295.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 85aa MW: 10474.9 Da PI: 10.2756 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 22.8 | 2.1e-07 | 36 | 74 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T++E++l+ + ++ G++ W++Ia ++ gR + ++ +w XP_013626295.1 36 MTEQEEDLISRMYRLVGNR-WDLIAGRVA-GRRASEIERYW 74 7******************.*********.**********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.4E-5 | 32 | 80 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.40E-4 | 35 | 74 | No hit | No description |
Pfam | PF00249 | 1.1E-6 | 36 | 75 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-9 | 36 | 75 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.64E-6 | 37 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MDDTNRLRRL RSHKHTKFIR HNSEEVTSIK WEFINMTEQE EDLISRMYRL VGNRWDLIAG 60 RVAGRRASEI ERYWIMKNND YFSKQ |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescences and trichomes of rosette and cauline leaves. {ECO:0000269|PubMed:20622149}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269|PubMed:17933793}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013626295.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY234411 | 1e-48 | AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. | |||
GenBank | AY519520 | 1e-48 | AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds. | |||
GenBank | AY649255 | 1e-48 | AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013626295.1 | 5e-57 | PREDICTED: MYB-like transcription factor TCL1 | ||||
Refseq | XP_013680730.1 | 5e-57 | MYB-like transcription factor TCL1 | ||||
Swissprot | D3GKW6 | 8e-41 | TCL1_ARATH; MYB-like transcription factor TCL1 | ||||
TrEMBL | A0A078GC02 | 1e-55 | A0A078GC02_BRANA; BnaC03g16910D protein | ||||
TrEMBL | A0A0D3B482 | 1e-55 | A0A0D3B482_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6A880 | 1e-55 | A0A3P6A880_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g024610.1 | 2e-56 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30432.1 | 3e-43 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|