PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013625045.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 299aa MW: 34361.1 Da PI: 5.5319 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.9 | 3.2e-15 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++ Ed+ l+ ++++G ++W++ ++ g+ R++k+c++rw +yl XP_013625045.1 16 RGPWSPKEDLTLITFIQKHGHHNWRSLPKLAGLMRCGKSCRLRWINYL 63 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.7 | 1.8e-15 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE++ +++ ++ lG++ W++Ia+ ++ gRt++++k+ w+++l XP_013625045.1 69 RGNFSKEEEDAIIHFHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.855 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.03E-29 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-11 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-14 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.43E-9 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 23.794 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-26 | 67 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-14 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-14 | 69 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.16E-10 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009866 | Biological Process | induced systemic resistance, ethylene mediated signaling pathway | ||||
GO:0071281 | Biological Process | cellular response to iron ion | ||||
GO:0071732 | Biological Process | cellular response to nitric oxide | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 299 aa Download sequence Send to blast |
MGKGRAPCCD KSKVKRGPWS PKEDLTLITF IQKHGHHNWR SLPKLAGLMR CGKSCRLRWI 60 NYLRPDVKRG NFSKEEEDAI IHFHQTLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRLFP 120 NSSSYSSISC PNDRPTEADQ KKNYAIVQEE RNSRDNESQD PPSSSHLHGK HMHTKPELDE 180 VNELHEIQLL LDHDDFDDIT SAFLQTTETL FPVQPLDSLL QTPTLTGFHN TGGATQEATE 240 PQSFDHSQPE IPCGFEETNG EFDLWSQPSP NSEEFDEWLS FMDNQTYFDD FTLFGEVCL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-26 | 16 | 118 | 7 | 108 | B-MYB |
1gv2_A | 7e-26 | 16 | 118 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 2e-25 | 16 | 118 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-25 | 16 | 118 | 58 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 8e-26 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 8e-26 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted (PubMed:18088336, PubMed:24278034). Involved in the up-regulation of several biosynthesis genes of secondary metabolites involved in iron uptake under conditions of iron deficiency (PubMed:25138267). Triggers tolerance to nickel (Ni) and zinc (Zn) ions (PubMed:24278034). Required in the roots during early signaling steps of rhizobacteria-mediated (e.g. P.fluorescens WCS417r) and beneficial fungi-mediated (e.g. T.asperellum T34) broad-spectrum induced systemic resistance (ISR) against several pathogens (e.g. P.syringae pv tomato, H.parasitica, P.cucumerina, A.brassicicola and B.cinerea) and implying enhanced callose deposition (PubMed:18218967, PubMed:19121118). Required for the induction of some genes (e.g. BGLU42) upon rhizobacteria-mediated ISR (PubMed:25138267). {ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:18218967, ECO:0000269|PubMed:19121118, ECO:0000269|PubMed:24278034, ECO:0000269|PubMed:25138267}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013625045.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates strongly in the root stele when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Accumulates upon potassium ion (K) depletion (PubMed:15489280). Induced in roots by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). Specifically activated in the roots upon colonization by nonpathogenic P.fluorescens WCS417r (PubMed:18218967). {ECO:0000269|PubMed:15489280, ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:18218967, ECO:0000269|PubMed:24278034}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013625045.1 | 0.0 | PREDICTED: myb-related protein 308 | ||||
Swissprot | Q9SGU3 | 1e-134 | MYB72_ARATH; Transcription factor MYB72 | ||||
TrEMBL | A0A078FAS2 | 0.0 | A0A078FAS2_BRANA; BnaC03g71080D protein | ||||
TrEMBL | A0A0D3BNE8 | 0.0 | A0A0D3BNE8_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6BWV9 | 0.0 | A0A3P6BWV9_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g185830.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56160.1 | 1e-136 | myb domain protein 72 |