PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_013623272.1

Organism

Brassica oleracea

Taxonomic ID

3712

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

TALE

Protein Properties

Length: 320aa MW: 37034.6 Da PI: 6.5693

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013623272.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	28.9	2e-09	246	281	20	55
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ XP_013623272.1 246 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 281 5679*****************************885 PP
2	ELK	36.2	1.2e-12	201	222	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsgyL+sLkqE+s XP_013623272.1 201 ELKNHLLKKYSGYLSSLKQELS 222 9*******************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01255	1.8E-22	53	97	IPR005540	KNOX1
Pfam	PF03790	1.8E-22	55	96	IPR005540	KNOX1
SMART	SM01256	1.1E-26	105	156	IPR005541	KNOX2
Pfam	PF03791	1.7E-24	110	155	IPR005541	KNOX2
Pfam	PF03789	6.1E-10	201	222	IPR005539	ELK domain
SMART	SM01188	1.0E-6	201	222	IPR005539	ELK domain
PROSITE profile	PS51213	11.243	201	221	IPR005539	ELK domain
PROSITE profile	PS50071	13.021	221	284	IPR001356	Homeobox domain
SuperFamily	SSF46689	9.84E-20	222	296	IPR009057	Homeodomain-like
SMART	SM00389	4.0E-13	223	288	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.3E-27	226	287	IPR009057	Homeodomain-like
CDD	cd00086	2.10E-11	233	285	No hit	No description
Pfam	PF05920	8.6E-17	241	280	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	259	282	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001708	Biological Process	cell fate specification
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010051	Biological Process	xylem and phloem pattern formation
GO:0010089	Biological Process	xylem development
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 320 aa Download sequence Send to blast
MEEYQHESRS TPHRPTNASV KSEASSSRIN HYSMLMKAIH NTQETNNNNN DTESMKAKII 60 AHPHYSTLLH AYLDCQKIGA PPEVVDKITA ARQEFEARQQ RPTASVTALS RDPELDQFME 120 AYCDMLVKYR EELTRPIEEA MEYIRRIESQ ISMLCQGPIH ILNNPDGKSE GIESSDEEQD 180 NNNSGGEAEL PEIDPRAEDR ELKNHLLKKY SGYLSSLKQE LSKKKKKGKL PKEARQKLLT 240 WWELHYKWPY PSESEKVALA ESTGLDQKQI NNWFINQRKR HWKPSEDMQF MVMDGLQHPH 300 HAALYMDGHY MGDGPYRLGP

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the vegetative meristem. Present in the base of flower primordia (PubMed:26390296). {ECO:0000269\|PubMed:12900451, ECO:0000269\|PubMed:26390296, ECO:0000269\|PubMed:7866029}.

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269\|PubMed:11934861, ECO:0000269\|PubMed:12900451, ECO:0000269\|PubMed:7866029}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013623272.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ATU14174	0.0	U14174.1 Arabidopsis thaliana clone KNAT1 knotted-like homeobox protein gene, partial cds.
GenBank	AY080834	0.0	AY080834.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
GenBank	AY113982	0.0	AY113982.1 Arabidopsis thaliana putative KNAT1 homeobox protein (At4g08150) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013623272.1	0.0	PREDICTED: homeobox protein knotted-1-like 1 isoform X2
Swissprot	P46639	0.0	KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBL	A0A0D3B7T2	0.0	A0A0D3B7T2_BRAOL; Uncharacterized protein
TrEMBL	C5MKB5	0.0	C5MKB5_BRAOL; BREVIPEDICELLUS (Fragment)
STRING	Bo3g043050.1	0.0	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	0.0	KNOTTED-like from Arabidopsis thaliana

Publications ? help Back to Top
dela Paz JS, et al. Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events. PLoS Genet., 2012. 8(12): p. e1003136 [PMID:23284301] Liu C, et al. Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] Liu B, et al. NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(17): p. 5345-57 [PMID:23963677] Simonini S,Kater MM Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering. Gene, 2016. 587(2): p. 120-31 [PMID:27154816] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA Nonreciprocal complementation of KNOX gene function in land plants. New Phytol., 2017. 216(2): p. 591-604 [PMID:27886385] Woerlen N, et al. Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root. Planta, 2017. 245(6): p. 1079-1090 [PMID:28204875] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Wang X, et al. Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana. Sci China Life Sci, 2018. 61(1): p. 79-87 [PMID:28887625] Simonini S,Stephenson P,Østergaard L A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] Felipo-Benavent A, et al. Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856]