PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013620184.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 25311.8 Da PI: 7.5105 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 60.8 | 1.6e-19 | 45 | 92 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 k ienks qvtfskRr+g++ KA LSvLC+ vav+++s +gkly XP_013620184.1 45 KLIENKSSTQVTFSKRRTGLIEKARQLSVLCESSVAVLVVSASGKLYN 92 569*******************************************96 PP | |||||||
2 | K-box | 36.3 | 2.4e-13 | 130 | 200 | 28 | 98 |
K-box 28 ienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +e L++ + +l ++++ s+ L +Le+qLe++l+ R++K+el +e ++ lq+ke+ l+een L +++ XP_013620184.1 130 NELLESVKSNLEESNVDNVSVDSLISLEDQLETALSATRARKTELTMEFVKMLQEKEELLREENLVLASQI 200 7888888889999999************************************************9999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.4E-28 | 37 | 96 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.33E-24 | 37 | 109 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.96 | 37 | 97 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-20 | 39 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-18 | 47 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-20 | 59 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-20 | 74 | 95 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.62 | 116 | 206 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.4E-10 | 130 | 200 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010048 | Biological Process | vernalization response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MEKKIEINES KEAKTLRVSS DIRLKLGHKA LSEEAAMGRR KVEIKLIENK SSTQVTFSKR 60 RTGLIEKARQ LSVLCESSVA VLVVSASGKL YNSSSGDNMT NIIDRYGIQH ACELRSLDLA 120 EKTRSYLPHN ELLESVKSNL EESNVDNVSV DSLISLEDQL ETALSATRAR KTELTMEFVK 180 MLQEKEELLR EENLVLASQI GKTNGGRQNN SPANSSGINP PETLPLLK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots, leaves and flowers, and, to a lower extent, in inflorescence, siliques, pollen and shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. Landsberg erecta than in cv. Columbia background. Prevents premature flowering (PubMed:12724541, PubMed:25339407). Involved in the modulation of vernalization impact on flowering according to genotype acclimation to altitude (PubMed:25339407). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:25339407}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013620184.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed during vernalization (PubMed:12724541). Regulated by HAM1 and HAM2 via epigenetic modification of chromatins at H4K5 acetylation during flowering (PubMed:23273925). {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:23273925}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC166741 | 1e-155 | AC166741.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH080C09, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013620184.1 | 1e-163 | PREDICTED: agamous-like MADS-box protein AGL27 isoform X1 | ||||
Swissprot | Q9LSR7 | 3e-90 | AGL70_ARATH; Agamous-like MADS-box protein AGL70 | ||||
TrEMBL | A0A0D3AYS0 | 1e-161 | A0A0D3AYS0_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g166500.1 | 1e-162 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65060.1 | 1e-79 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|