PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013619312.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 198aa MW: 22395.7 Da PI: 7.5374 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 87.8 | 9.5e-28 | 108 | 166 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYG+K+vk++++ r+YY+C+s+gC+vkk+ver+ e+ +v++tYeg Hnhe XP_013619312.1 108 MDDGYKWRKYGKKSVKNNTNKRNYYKCSSEGCMVKKRVERDGENAAYVITTYEGVHNHE 166 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.7E-30 | 95 | 168 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.35E-26 | 100 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.656 | 103 | 168 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.5E-31 | 108 | 167 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.0E-22 | 109 | 166 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MNPSQSPSPN FTFLSDENSI YSFMDNYDFS NLMFSVGEGG NNGLIQEETS SPTTFVTGES 60 GGSGSALTTL RKKESTSLDC KNRGSKDGET KEMGHRVAIR TRTKIDVMDD GYKWRKYGKK 120 SVKNNTNKRN YYKCSSEGCM VKKRVERDGE NAAYVITTYE GVHNHESPSH VYYSDMVYDH 180 DNWKQHSLLQ SIQTFPPC |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 8e-24 | 96 | 168 | 2 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013619312.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430060 | 0.0 | KF430060.1 Brassica rapa WRKY transcription factor 51 (WRKY51) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013619312.1 | 1e-148 | PREDICTED: probable WRKY transcription factor 51 isoform X1 | ||||
Swissprot | Q93WU9 | 4e-99 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | V5RF86 | 1e-143 | V5RF86_BRACM; WRKY transcription factor 51 | ||||
STRING | Bra031900.1-P | 1e-141 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5711 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-101 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|