PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013618693.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 217aa MW: 24842.9 Da PI: 8.7033 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 42 | 87 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE+ l +++++++G++ W++Iar+++ gRt++++k++w++++ XP_013618693.1 42 RGKMTPEEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 4.646 | 1 | 36 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-10 | 22 | 48 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.01E-23 | 22 | 91 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 27.675 | 37 | 91 | IPR017930 | Myb domain |
SMART | SM00717 | 6.5E-18 | 41 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.3E-17 | 42 | 86 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.37E-13 | 44 | 87 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-21 | 49 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MGFCSESFRF EGGGRNIRIG LNRTGKSCRL RWVNYLHPGL KRGKMTPEEE RLVLELHAKW 60 GNRWSKIARK LPGRTDNEIK NYWRTHMRKI AQEKKRPMSP TSSSSNFCSS SMTTATTQDT 120 GGSKGKMNQE CEDGYYSMDD IWREIDQSGE SITKPVKGMY YSEQSCYLNF PPLASPAWES 180 SLESIWNMDA DESKMSSFAI DQFPLSFEHG SSWSSLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-18 | 23 | 89 | 37 | 103 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 7e-18 | 23 | 89 | 91 | 157 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 7e-18 | 23 | 89 | 91 | 157 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 4e-18 | 23 | 89 | 60 | 126 | MYB TRANSFORMING PROTEIN |
1mse_C | 2e-18 | 23 | 89 | 37 | 103 | C-Myb DNA-Binding Domain |
1msf_C | 2e-18 | 23 | 89 | 37 | 103 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013618693.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ075253 | 0.0 | DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013618693.1 | 1e-162 | PREDICTED: transcription factor MYB59 isoform X2 | ||||
Swissprot | Q4JL84 | 1e-122 | MYB59_ARATH; Transcription factor MYB59 | ||||
TrEMBL | A0A0D3AKW5 | 1e-145 | A0A0D3AKW5_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6D7L6 | 1e-145 | A0A3P6D7L6_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g025410.1 | 1e-146 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.2 | 1e-123 | myb domain protein 59 |
Publications ? help Back to Top | |||
---|---|---|---|
|