PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 321aa    MW: 35875.5 Da    PI: 7.7753
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616700.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.6e-052060640
        zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    C+++ +   + +C+ ++ +lC++C  + H        H++v
  XP_013616700.1 20 CNTCRSAACTVYCRADSAYLCATCDAQVHAAnllasrHERV 60
                    ******99*********************657788888776 PP

2zf-B_box31.34.1e-1060105342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      r+C+ +e+ ++ +fC+ +   lC  C ++ H        H++vp+
  XP_013616700.1  60 VRVCEACERAPAAFFCKADAASLCIACDSQVHLAnplarrHQRVPI 105
                     689*****************************55577777999987 PP

3CCT67.82.9e-23252296145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     Rea+++RY+eK+ktRkFeK++rY+sRKa+Ae+RpR+KGrFvk++e
  XP_013616700.1 252 REARVMRYREKKKTRKFEKRVRYASRKAYAETRPRIKGRFVKREE 296
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8221562IPR000315B-box-type zinc finger
SMARTSM003362.0E-71562IPR000315B-box-type zinc finger
CDDcd000212.54E-62062No hitNo description
PROSITE profilePS5011912.27358105IPR000315B-box-type zinc finger
PfamPF006435.4E-860105IPR000315B-box-type zinc finger
CDDcd000213.39E-961105No hitNo description
SMARTSM003362.0E-1063105IPR000315B-box-type zinc finger
PfamPF062031.1E-17252294IPR010402CCT domain
PROSITE profilePS5101716.847252294IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MLKQERNRTK VCNTCRSAAC NTCRSAACTV YCRADSAYLC ATCDAQVHAA NLLASRHERV  60
RVCEACERAP AAFFCKADAA SLCIACDSQV HLANPLARRH QRVPILPISS MATNHSSETT  120
AMTDPENIVV MGQEEEDETE VASWLLPSSE KNNNNSLDLV DCQQDYNVVP RSRYARDGVV  180
PLQVEESKAH VHHEQHNFQF GFTNVSSGCH MVSLVLESTS SDTTVLLHSP SPKAATDQLP  240
DPSIQIFSPG EREARVMRYR EKKKTRKFEK RVRYASRKAY AETRPRIKGR FVKREEVDAE  300
ADQGFPTMIM FNTGYGVVPS L
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves and at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013616700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400870.0AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616700.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1-like
RefseqXP_013659923.10.0zinc finger protein CONSTANS-LIKE 1-like
SwissprotO500551e-126COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLA0A0D3AJ980.0A0A0D3AJ98_BRAOL; Uncharacterized protein
STRINGBo2g012810.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-104CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]