PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013615783.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 129aa MW: 14938.2 Da PI: 9.6344 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 79.9 | 3e-25 | 66 | 114 | 3 | 51 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 r++W+++LH+r v+a++++GGs++AtPk+i+++mkv+gLt+++vkSHLQ XP_013615783.1 66 RRKWSENLHRRIVDALQKIGGSQVATPKQIRDIMKVDGLTNDEVKSHLQ 114 99*********************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-20 | 62 | 114 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.51E-10 | 62 | 115 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.5E-21 | 66 | 115 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
THEEENMCVT QTCNNNNANQ REAIMSFNRP PPPPLSAPLS LQKSEILTDY SSRIEQSHPI 60 QKKELRRKWS ENLHRRIVDA LQKIGGSQVA TPKQIRDIMK VDGLTNDEVK SHLQVKVLIF 120 FFLYKLEKL |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, inflorescence apex, floral primordia, stamen primordia, carpel primordia and ovules. {ECO:0000269|PubMed:26903506}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower. Binds specifically to the DNA sequence motif 5'-GTAGATTCCT-3' of WUS promoter, and may be involved in direct regulation of WUS expression. Binds specifically to the DNA sequence motif 5'-AAGAATCTTT-3' found in the promoters of AG and the NAC domain genes CUC1, CUC2 and CUC3, and may be involved in direct regulation of these gene expressions. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013615783.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013615783.1 | 1e-92 | PREDICTED: protein PHR1-LIKE 1-like, partial | ||||
Swissprot | F4JRB0 | 4e-33 | HHO5_ARATH; Transcription factor HHO5 | ||||
TrEMBL | A0A0D2ZYM5 | 1e-74 | A0A0D2ZYM5_BRAOL; Uncharacterized protein | ||||
STRING | Bo09513s010.1 | 2e-75 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4922 | 26 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37180.1 | 1e-34 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|