PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013611017.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 232aa MW: 25878.6 Da PI: 6.5105 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.8 | 2.2e-17 | 22 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw++yl XP_013611017.1 22 KGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYL 69 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.7 | 9.6e-17 | 75 | 118 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++ + ++++++G++ W++Ia++++ gRt++++k++w++ XP_013611017.1 75 RGNITPEEQLTIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 118 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.998 | 17 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.09E-29 | 20 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-12 | 21 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-16 | 22 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-23 | 23 | 76 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.73E-10 | 24 | 69 | No hit | No description |
PROSITE profile | PS51294 | 24.291 | 70 | 124 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-14 | 74 | 122 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-15 | 75 | 118 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-24 | 77 | 123 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.55E-11 | 79 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0080086 | Biological Process | stamen filament development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
METIGGISSG GTGSSGEAEV RKGPWTMEED LILINYIANH GDGVWNSLAK SAGLKRTGKS 60 CRLRWLNYLR PDVRRGNITP EEQLTIMELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTRI 120 QKYIKQTDVT ATTTSSVGSH HSSEINDQVA STSNHNVFCT QDQAMETYSP TTTSYQHTNM 180 DFNYGNYSAA AATATATTTA DYSIPMTVDD QTGENYWGMD DIWSSMHLLN GN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-25 | 19 | 124 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19325888, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013611017.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN703995 | 0.0 | JN703995.1 Brassica oleracea MYB1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013611017.1 | 1e-174 | PREDICTED: transcription factor MYB21 | ||||
Swissprot | Q9LK95 | 1e-149 | MYB21_ARATH; Transcription factor MYB21 | ||||
TrEMBL | A0A0D3E0I2 | 1e-173 | A0A0D3E0I2_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g008370.1 | 1e-174 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 1e-133 | myb domain protein 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|