PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013610102.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 176aa MW: 19281.8 Da PI: 8.371 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 142.6 | 1.3e-44 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l+++l+ XP_013610102.1 12 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKDLD 106 7*********************************************************************************************9 PP DUF260 96 llke 99 ++++ XP_013610102.1 107 AANA 110 9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 28.013 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.3E-44 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MASSSSNTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPHK FANVHKIFGA SNVTKLLNEL 60 LPHQREDAVN SLAYEAEARV RDPVYGCVGA ISYLQRQVHR LQKDLDAANA DLVHYGLSTS 120 TPSNVVDLVF QPQPLPQQPQ PLNPVYRLPG ASRGTGGSCG TFLPWNNGHN QQGGNM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-65 | 2 | 122 | 1 | 127 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-65 | 2 | 122 | 1 | 127 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013610102.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB008265 | 1e-140 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
GenBank | AB164305 | 1e-140 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
GenBank | AB473837 | 1e-140 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
GenBank | AF447897 | 1e-140 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
GenBank | BT025745 | 1e-140 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
GenBank | CP002688 | 1e-140 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013610101.1 | 1e-130 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_013610102.1 | 1e-130 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 1e-114 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A0D3E1Z6 | 1e-129 | A0A0D3E1Z6_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g017470.1 | 1e-129 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-107 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|