PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013609964.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 147aa MW: 17043.1 Da PI: 9.976 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.1 | 7.8e-33 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt+ gC+vkk+v+r ++d++vv++tYeg H h+ XP_013609964.1 68 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYGGCNVKKQVQRLTSDQEVVVTTYEGVHSHP 126 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 53 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-29 | 60 | 127 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.136 | 63 | 128 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.8E-38 | 68 | 127 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-26 | 69 | 126 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MEGYNDGSLY APFLSLKPHQ SLSKSELEQG REEASKVSEG SSRSRDLKKK KGKKQKFAFQ 60 TRSQVDILDD GYRWRKYGQK AVKNNKFPRS YYRCTYGGCN VKKQVQRLTS DQEVVVTTYE 120 GVHSHPIEKS TENFEHILTQ MQIYSSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-29 | 52 | 125 | 1 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013609964.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM593162 | 0.0 | KM593162.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY106) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013609964.1 | 1e-107 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-82 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A0D3EFW1 | 1e-105 | A0A0D3EFW1_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g169080.1 | 1e-106 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 9e-83 | WRKY DNA-binding protein 75 |